$FL2@(#) SPSS DATA FILE MS Windows Release 15.0.0 Y@29 Oct 0716:14:48 SCCS# SOCNAME  LATITUDELatitude in Degrees LONGITUDLongitude in DegreesOUTLINEFCoastal Cities code-99 AGRICSYSAgricultural systemsV7_A STATEHOOStatehood Index V0_STATEState/NonStatePaige V1 #Intercommunity Trade as Food Source V2 Food Import Acquisition V3 -Agriculture-Contribution to Local Food Supply V4 Crops-Principal V5 ,Animal Husbandry-Contribution to Food SupplyV6 Animals-DomesticatedV7 #Fishing-Contribution to Food Supply V8 FishV9 #Hunting-Contribution to Food Supply V10 Animals Hunted V11 'Gathering - Contribution to Food Supply V12 Gathered Foods V13 Land Transport V14 Routes of Land TransportV15 Water Transport V16 Water Craft V17 $Money (Media of Exchange) and CreditV18 Credit Source V19 Perservation and Storage of FoodV20 Food StorageV21 Food Surplus Via StorageV22 0Food Supply (Ecological Or Distribution Network)V23 'Sleeping Proximity of Parents to Infant V24 $Bodily Restrictiveness-Early InfancyV25 $Bodily Restrictiveness-Later InfancyV26 Bodily Contact-Early InfancyV27 Bodily Contact-Late Infancy V28 Infant Carrying Devices V29 Infant Carrying PositionV30 Infant Eye Contact with Carrier V31 Infant Crying-Response V32 Infant Crying-AmountV33 Childhood Pain Infliction V34 Post-Partum Sex Taboo V35 6Ceremonialism Surrounding Child, beyond Nuclear Family V36 3Magical Protectiveness Applied To Parents and Child V37 4Physical Protectiveness Applied to Parents and ChildV38 8Introduction of New Foods (Other Than Milk) in ChildhoodV39 Weaning-Age and SeverityV40 'Motor Skills-Encouragement in Childhood V41 #Autonomy-Encouragement in Childhood V42 1Elimination-Encouragement of Control in Childhood V43 Covering Genitals-age V44 Weaning-age of onsetV45 Weaning-age of Termination V46 .Weaning-Childhood Developmental Order of Onset V47 )Motor Skils-Childhood Developmental Order V48 &Autonomy-Childhood Developmental Order V49 1Elimination Control-Childhood Developmental Order V50 .Covering Genitals-Chldhood Developmental Order V51 Non-Maternal Relations, Infancy V52 +Non-maternal Relationships, Early Childhood V53 Role of Father, Infancy V54 Role of Father, Early Childhood V55 :Principal Relationships, Infancy Caretakers and Companions V56 BPrincipal Relationships, Early Childhood Caretakers and Companions V57 General Indulgence, Infancy V58 <General Indulgence, Infancy-Modifiers or General Scale TypesV59 #General Indulgence, Early Childhood V60 DGeneral Indulgence, Early Childhood-Modifiers of General Scale TypesV61 Fixity of SettlementV62 Compactness of Settlement V63 Community Size V64 Population Density V65 Types of Dwelling V66 Large or Impressive Structures V67 Household Form V68 Form of Family V69 Marital Residence V70 -Descent-Membership in Coporate Kinship Groups V71 -Descent groups, Location of Core Gender Group V72 Intercommunity Marriage V73 Community Intergration V74 Prominent Community Ceremonials V75 Ceremonial Elements V76 Community LeadershipV77 #Local Political Succession, Primary V78 %Local Political Succession, secondary V79 PolygamyV80 Family size V81 Political Autonomy V82 Trend in Autonomy V83 Levels of Sovereignty V84 Higher Political Organization V85 Executive V86 Selection of Executive V87 "Deliberate And Consultative Bodies V88 Advisory Bodies V89 Judiciary V90 Police V91 Administrative HierarchyV92 "Selection of Subordinate Officials V93 &Political Power- Most Important Source V94 -Political Power- Second Most Important Source V95 ,Political Power- Third Most Important SourceV96 -Political Power- Fourth Most Important Source V97 ,Political Power- Fifth Most Important SourceV98 ,Political Power- Sixth Most Important SourceV99 Vegetal - Food Collection V100 !Eggs, Insects, & small land fauna V101 Shellfish/Small Aquatic Fauna V102 Honey - Food Collection V103 Fowling - Food Collection V104 Fishing V105 TrappingV106 "Large Land Fauna - Food Collection V107 %Large Aquatic Fauna - Food Collection V108 Land Clearance V109 Soil PreparationV110 PlantingV111 Crop TendingV112 Harvesting V113 Small Domestic Animals V114 Large Domestic Animals V115 Milking V116 Vegetable V117 Butchering V118 PreservationV119 Drinks V120 Dairy V121 Cooking V122 Mining/QuarryingV123 Fuel Gathering V124 Lumbering V125 Water Fetching V126 Preparation of SkinsV127 SpinningV128 Loom WeavingV129 SmeltingV130 Matmaking V131 Netmaking V132 BasketmakingV133 Making of Rope or Cordage V134 Leather V135 ClothingV136 Pottery V137 WoodV138 BoneV139 Stone V140 MetalworkingV141 Musical Instruments V142 FireV143 Laundering V144 Bodily Mutilation V145 Bonesetting/Surgery V146 Burden Carrying V147 BoatbuildingV148 Housebuilding TOTSEXLAFOCYEAR V149 Writing and Records V150 Fixity of Residence V151 Agriculture V152 UrbanizationV153 Technological SpecializationV154 Land Transport V155 Money V156 Density of Population V157 Political Integration V158 Social Stratification V158.1MO%Sum of Cultural Complexity (v149-158) V159 Talk About Sex V160 Sex Frequency in Marriage V161 Sex Believed Dangerous V162 ForeplayV163 Age for Clothing - Male V164 Age for Clothing - Female V165 !Premarital Sex Attitudes - Female V166 "Frequency of Premarital Sex - Male V167 "Frequency of Premarital Sex-Female V168 Initiator of Premarital Sex V169 Extramarital SexV170 $Frequency of Extramarital Sex - MaleV171 &Frequency of Extramarital Sex - Female V172 Wifesharing V173 RapeV174 Frequency of Rape V175 Male Sexual Aggressiveness V176 Homosexuality V177 Frequency of Homosexuality V178 Impotence V179 Latitude of Weather Station V180 Latitude Hemisphere V181 Longtitude of Weather Station V182 Longtitude Hemisphere V183 Altitude in Meters V184 "Years of Observation - Temperature V185 $Years of Observation - PrecipitationV186 Mean Annual Temperature V187 Hottest North Mean Temperature V188 #Coldest Month Mean Temperature (xc) V189 Mean Annual Precipitation V190 !Mean Daily Min Coldest Month (xc) V191 !Mean Daily Max Hottest Month (xc) V192 +Highest Precipitation in Wettest MOnth (mm) V193 )Lowest Precipitation in Dryest Month (mm) V194 Wettest Month V195 Dryest MonthV196 Number of Dry MonthsV197 Hottest Month V198 Coldest Month V199 Number of Frost Months V200 Region V201 V202 V203 Dependence on Gathering V204 Dependence on Hunting V205 Dependence on Fishing V206 Dependence on Animal Husbandry V207 Dependence on Agriculture V208 Mode of MarriageV209 Mode of Marriage (Alternate)V210 Domestic Organization V211 Composition of Domestic Group V212 ,Marital Composition Within Extended FamiliesV213 'Marital Residence with Kin: First Years V214 .Transfer Of Residence at Marriage: First Years V215 -Marital Residence with Kin: After first years V216 .Transfer of Residence at Marriage: First Years V217 *Marital Residence with Kin: Alternate Form V218 1Transfer of Residence at Marriage: Alternate Form V219 Community Marriage Organization V220 +Community Marriage Organization (Alternate) V221 Largest Patrilineal Kin Group V222 2Largest Patrilineal Exogamous Group (if different) V223 Largest Matrilineal Kin Group V224 2Largest Matrilineal Exogamous Group (if different) V225 Cognatic Kin Groups V226 =Secondary Cognatic Kin Group: Where both Kindreds and Ramages V227 $Number of Cousin Marriages (Allowed)V228 &Number of Cousin Marriages (Preferred) V229 &Subtypes of Cousin Marriages (Allowed) V230 (Subtypes of Cousin Marriages (Preferred)V231 Kin Terms for Cousins V232 Intensity of CultivationV233 Major Crop Type V234 Settlement Patterns V235 Mean Size of Local Communities V236 +Jurisdictional Hierarchy of Locla Community V237 0Jurisdictional Hierarchy Beyond Local CcommunityV238 High Gods V239 Games V240 Post-Partum Sex Taboos V241 Male Genital MutilationsV242 Segregation of Adolescent Boys V243 Animals and Plow CultivationV244 $Predominant Type of Animal HusbandryV245 Milking of Domestic Animals V246 Subsistence Economy V247 Descent: Major Type V248 Sex Differences in Metal WorkingV249 Sex Differences in Weaving V250 #Sex Differences in Leather Working V251 !Sex Differences in Pottery Making V252 Sex Differences in Boat BuildingV253 %Sex Differences in House Construction V254 3Age or Occupational Specialization in Metal Working V255 *Age or Occupational Specialization Weaving V256 5Age or Occupational Specialization in Leather Working V257 4Age or Occupational Specialization in Pottery MakingV258 3Age or Occupational Specialization in Boat Building V259 8Age or Occupational Specialization in House ConstructionV260 Sex Differences in GatheringV261 Sex Differences in Hunting V262 Sex Differences in Fishing V263 #Sex Differences in Animal Husbandry V264 Sex Differences in Agriculture V265 /Age or Occupational Specialization in Gathering V266 -Age or Occupational Specialization in Hunting V267 -Age or Occupational Specialization in Fishing V268 6Age or Occupational Specialization in Animal Husbandry V269 Murdock's Language CodesV270 Class StratificationV271 'Class Stratification, Secondary Feature V272 Caste Stratification (Endogamy) V273 $Caste Stratification, Secondary TypeV274 Type of Slavery V275 Former Presence of Slavery V276 )Succession to the Office of Local Headman V277 ISuccession to Office of Local Headman, Breakdown of Hereditary Succession V278 #Inheritance of Real Property (Land) V279 Inheritance of Movable Property V280 *Inheritance distribution for Real Property V281 Inheritance of Movable Property V282 )Norms of Premarital Sex behavior of Girls V283 (Prevailing Type of Dwelling: Ground PlanV284 (Prevailing type of Dwelling: Floor LevelV285 +Prevailing Type of Dwelling: Wall Material V286 *Prevailing type of Dwelling: Shape of Roof V287 .Prevailing Type of Dwelling: Roofing Materials V288 0Secondary or Alternative House Type: Ground PlanV289 0Secondary or Alternative House Type: Floor LevelV290 2Secondary or Alternative House Type: Wall Material V291 2Secondary or Alternative House Type: Shape of Roof V292 6Secondary or Alternative House Type: Roofing Materials V293 Duration of Early Childhood V294 Fortitude: Early BoyV295 Fortitude: Early Girl V296 Fortitude: Late Boy V297 Fortitude: Late GirlV298 Aggression: Early Boy V299 Aggression: Early Girl V300 Aggression: Late BoyV301 Aggression: Late Girl V302 Competitiveness: Early Boy V303 Competitiveness: Early Girl V304 Competitiveness: Late Boy V305 Competitiveness: Late Girl V306 Self-Reliance: Early BoyV307 Self-Reliance: Early Girl V308 Self-Reliance: Late Boy V309 Self-Reliance: Late GirlV310 Achievement: Early Boy V311 Achievement: Early Girl V312 Achievement: Late Boy V313 Achievement: Late Girl V314 Industry: Early BoysV315 Industry: Early GirlV316 Industry: Late Boy V317 Industry: Late Girl V318 Responsibility: Early Boy V319 Responsibility: Early Girl V320 Responsibility: Late BoyV321 Responsibility: Late Girl V322 Obedience: Early BoyV323 Obedience: Early Girl V324 Obedience: Late Boy V325 Obedience: Late GirlV326 Self-Restraint: Early Boy V327 Self-Restraint: Early Girl V328 Self-Restraint: Late BoyV329 Self-Restraint: Late Girl V330 Sexual Restraint: Early Boy V331 Sexual Restraint: Early GirlV332 Sexual Restraint: Late Boy V333 Sexual Restraint: Late Girl V334 Generosity V335 Trust V336 Honesty V337 .Importance of Non-Family Companions: Early Boy V338 /Importance of Non-Family Companions: Early Girl V339 -Importance of Non-Family Companions: Late Boy V340 .Importance of Non-Family Companions: Late Girl V341 Sex of Companions: Early BoyV342 Sex of Companions: Early Girl V343 Sex of Companions: Late Boy V344 Sex of Companions: Late GirlV345 0Importance of Non-Parent in Residence: Early BoyV346 1Importance of Non-Parent in Residence: Early Girl V347 /Importance of Non-Parent in Residence: Late Boy V348 0Importance of Non-Parent in Residence: Late GirlV349 3Principal Category of Non-Parental Agent: Early Boy V350 4Principal Category of Non-Parental Agent: Early GirlV351 2Principal Category of Non-Parental Agent: Late Boy V352 3Principal Category of Non-Parental Agent: Late Girl V353 &Sex of Parents in Residence: Early Boy V354 'Sex of Parents in Residence: Early Girl V355 %Sex of Parents in Residence: Late Boy V356 &Sex of Parents in Residence: Late Girl V357 *Sex of Non-parents in Residence: Early Boy V358 +Sex of Non-parents in Residence: Early Girl V359 )Sex of Non-parents in Residence: Late Boy V360 *Sex of Non-parents in Residence: Late Girl V361 3Non-parental Involvement in Child Caring: Early Boy V362 4Non-parental Involvement in Child Caring: Early GirlV363 2Non-parental Involvement in Child Caring: Late Boy V364 3Non-parental Involvement in Child Caring: Late Girl V365 )Early Boy: Principal Non-Parent Caretaker V366 *Early Girl: Principal Non-Parent Caretaker V367 (Late Boy: Principal Non-Parent CaretakerV368 )Late Girl: Principal Non-Parent Caretaker V369 %Sex of Parental Caretakers: Early Boy V370 &Sex of Parental Caretakers: Early Girl V371 $Sex of Parental Caretakers: Late BoyV372 %Sex of Parental Caretakers: Late Girl V373 3Sex of Principal Non-Parental Caretakers: Early Boy V374 4Sex of Principal Non-Parental Caretakers: Early GirlV375 2Sex of Principal Non-Parental Caretakers: Late Boy V376 3Sex of Principal Non-Parental Caretakers: Late Girl V377 0Non-Parental Involvement in Authority: Ealry BoyV378 1Non-Parental Involvement in Authority: Early Girl V379 /Non-Parental Involvement in Authority: Late Boy V380 0Non-Parental Invovlement in Authority: Late GirlV381 3Principal Non-Parental Authority Figures: Early Boy V382 4Principal Non-Parental Authority Figures: Early GirlV383 2Principal Non-Parental Authority Figures: Late Boy V384 3Principal Non-Parental Authority Figures: Late Girl V385 ,Sex of Parental Authority Figures: Early BoyV386 -Sex of Parental Authority Figures: Early Girl V387 +Sex of Parental Authority Figures: Late Boy V388 ,Sex of Parental Authority Figures: Late GirlV389 :Sex of Principal Non-Parental Authoriry Figures: Early Boy V390 ;Sex of Principal Non-Parental Authority Figures: Early Girl V391 9Sex of Principal Non-Parental Authority Figures: Late Boy V392 :Sex of Principal Non-Parental Authority Figures: Late Girl V393 1Non-Parental Involvement in Discipline: Early Boy V394 2Non-Parental Invovlement in Discipline: Ealry Girl V395 0Non-Parental Involvement in Discipline: Late BoyV396 1Non-Parental Involvement in Discipline: Late Girl V397 1Principal Non-Parental Disciplinarians: Early Boy V398 2Principal Non-Parental Disciplinarians: Early Girl V399 0Principal Non-Parental Disciplinarians: Late BoyV400 1Principal Non-Parental Disciplinarians: Late Girl V401 *Sex of Parental Disciplinarians: Early Boy V402 +Sex of Parental Disciplinarians: Early Girl V403 )Sex of Parental Disciplinarians: Late Boy V404 *Sex of Parental Disciplinarians: Late Girl V405 9Sex of Principal Non-Parental Disciplinarians: Early Boys V406 :Sex of Principal Non-Parental Disciplinarians: Early Girls V407 8sex of Principal Non-Parental Disciplinarians: Late BoysV408 9Sex of Principal Non-Parental Disciplinarians: Late Girls V409 1Non-Parental Involvement in Education: Early Boys V410 2Non-Parental Involvement in Education: Early Girls V411 0Non-Parental Involvement in Education: Late BoysV412 1Non-Parental Involvement in Education: Late Girls V413 9Principal Catergory of Non-Parental Educators: Early Boys V414 9Principal Category of Non-Parental Educators: Early Girls V415 7Principal Category of Non-Parental Educators: Late Boys V416 8Principal Category of Non-Parental Educators: Late GirlsV417 %Sex of Parental Educators: Early Boys V418 &Sex of Parental Educators: Early Girls V419 $Sex of Parental Educators: Late BoysV420 %Sex of Parental Educators: Late Girls V421 3Sex of Principal Non-Parental Educators: Early Boys V422 4Sex of Principal Non-Parental Educators: Early GirlsV423 2sex of Principal Non-Parental Educators: Late Boys V424 3Sex of Principal Non-Parental Educators: Late Girls V425 (Guidance or Formal Schooling: Early BoysV426 )Guidance or Formal Schooling: Early Girls V427 'Guidance or Formal Schooling: Late Boys V428 'Gidance or Formal Schooling: Late Girls V429 Use of Example: Early Boys V430 Use of Example: Early Girls V431 Use of Example: Late Boys V432 Use of Example: Late Girls V433 %Control by Public Opinion: Early Boys V434 &Control by Public Opinion: Early Girls V435 $Control by Public Opinion: Late BoysV436 %Control by Public Opinion: Late Girls V437 Lecturing: Early Boys V438 Lecturing: Early Girls V439 Lecturing: Late BoysV440 Lecturing: Late Girls V441 Teasing: Early Boys V442 Teasing: Early GirlsV443 Teasing: Late Boys V444 Teasing: Late Girls V445 Scolding: Early BoysV446 Scolding: Early Girls V447 Scolding: Late Boys V448 Scolding: Late GirlsV449 Warning: Early Boys V450 Warning: Early GirlsV451 Warning: Late Boys V452 Warning: Late Girls V453 Corporal Punishment: Early Boys V454 Corporal Punishment: Early GirlsV455 Corporal Punishment: Late Boys V456 Corporal Punishment: Late Girls V457 #Ceremonies for Children: Early Boys V458 $Ceremonies for Children: Early GirlsV459 "Ceremonies for Children: Late Boys V460 #Ceremonies for Children: Late Girls V461 'Gifts for Approved Behavior: Early Boys V462 (Gifts for Approved Behavior: Early GirlsV463 &Gifts for Approved Behavior: Late Boys V464 'Gifts for Approved Behavior: Late Girls V465 Permissiveness: Early Boys V466 Permissiveness: Early Girls V467 Permissiveness: Late Boys V468 Permissiveness: Late Girls V469 Affection: Early Boys V470 Affection: Early Girls V471 Affection: Late BoysV472 Affection: Late Girls V473 !Evaluation By Society: Early Boys V474 "Evaluation By Society: Early Girls V475 Evaluation By Society: Late BoysV476 !Evaluation By Society: Late Girls V477 &Incorporation into Society: Early Boys V478 'Incorporation into Society: Early Girls V479 %Incorporation into Society: Late Boys V480 &Incorporation into Society: Late Girls V481 .Warmth and Affection of Caretakers-Mother: Boy V482 /Warmth and Affection of Caretakers-Mother: Girl V483 /Warmth and Affection of Caretakers-Mother: Aver V484 .Warmth and Affection of Caretakers-Father: Boy V485 /Warmth and Affection of Caretakers-Father: Girl V486 /Warmth and Affection of Caretakers-Father: Aver V487 .Warmth and Affection of Caretakers-Others: Boy V488 /Warmth and Affection of Caretakers-Others: Girl V489 .Warmth and Affection of Caretakers-Other: Aver V490 /Warmth and Affection of Caretakers-Overall: Boy V491 /Warmth and Affection of Caretakers-Overall: Boy V492 0Warmth and Affection of Caretakers-Overall: AverV493 2Hostility and Aggression of Caretakers-Mother: Boy V494 3Hostility and Aggression of Caretakers-Mother: Girl V495 4Hostility and Aggression of Caretakers- Mother: AverV496 2Hostility and Aggression of Caretakers-Father: Boy V497 3Hostility and Aggression of Caretakers-Father: Girl V498 3Hostility and Aggression of Caretakers-Father: Aver V499 $Hostility and Aggression-Others: BoyV500 3Hostility and Aggression of Caretakers-Others: Girl V501 3Hostility and Aggression of Caretakers-Others: Aver V502 2Hostility and Aggression of Caretakers-Overall-Boy V503 4Hositlity and Aggression of Caretakers-Overall: GirlV504 4Hostility and Aggression of Caretakers-Overall: AverV505 &Indifference of Caretakers-Mother: Boy V506 &Indifference of Caretakers-Mother Girl V507 'Indifference of Caretkaers-Mother: Aver V508 %Indifference of Caretakers-Father Boy V509 'Indifference of Caretakers-Father: Girl V510 'Indifference of Caretakers-Father: Aver V511 &Indifference of Caretakers-Others: Boy V512 'Indifference of Caretakers-Others: Girl V513 &Indifference of Caretakers-Others-Aver V514 'Indifference of Caretakers-Overall: Boy V515 (Indifference of Caretakers-Overall: GirlV516 (Indifference of Caretakers-Overall: AverV517 !Control By Caretakers-Mother: Boy V518 "Control of Caretakers-Mother: Girl V519 "Control of Caretakers-Mother: Aver V520 !Control by Caretakers-Father: Boy V521 "Control By Caretakers-Father: Girl V522 "Control of Caretakers-Father: Aver V523 !Control by Caretakers-Others: Boy V524 "Control by Caretakers-Others: Girl V525 "Control by Caretakers-Others: Aver V526 #Control By Caretakerts-Overall: Boy V527 #Control by Caretakers-Overall: Girl V528 #Control by Caretakers-Overall: Aver V529 2Adolescent Initiation Ceremonies, Occurrence: Boys V530 3Adolescent Initiation Ceremonies, Occurrence: Girls V531 ,Adolescent Initiation Ceremonies, Time: BoysV532 -Adolescent Initiation Ceremonies, Time: Girls V533 $Number of Concurrent Initiates: BoysV534 %Number of Concurrent Initiates: Girls V535 Duration of Ceremony: Boys V536 Duration of Ceremony: Girls V537 Number of Participants: BoysV538 Number of Participants: Girls V539 Sexes of Participants: Boys V540 Sexes of Participants: GirlsV541 !Primary Physical Components: Boys V542 "Primary Physical Components: Girls V543 #Secondary Physical Components: Boys V544 $Secondary Physical Components: GirlsV545 1Primary Cognitive or Performance Components: Boys V546 2Primary Cognitive or Performance Components: Girls V547 2Secondary Cognitive or Performance Componets: Boys V548 4Secondary Cognitive or Performance Components: GirlsV549 "Primary Emic Interpretations: Boys V550 #Primary Emic Interpretations: Girls V551 $Secondary Emic Interpretations: BoysV552 %Secondary Emic Interpretations: Girls V553 #Tertiary Emic Interpretations: Boys V554 #Teriary Emic Interpretations: Girls V555 Primary Social Conseqences: BoysV556 "Primary Social Consequences: Girls V557 #Secondary Social Consequences: Boys V558 $Secondary Social Consequences: GirlsV559 Principal Focus: Boys V560 Principal Focus: Girls V561 Menarcheal Ceremonies V562 CircumcisionV563 Maternal Restrictions V564 #Husband Involvement Scale (Couvade) V565 Menstrual Segregation V566 Male Segregation Practices V567 Combined Segregation Practices V568 Compensation DemandsV569 Fraternal Interest Group Size V570 !Fraternal Interest Group Strength V571 Resource Base V572 Residence Pattern V573 Ritual Warfare V574 /Achieved Leadership Through Wealth Distribution V575 Unstable Political Power Index V576 6Sex of Gods and Spirits and Other Super-Natural Beings V577 Mythical Founders of the CultureV578 Sex of Shamans V579 Sex of Reputed Witches V580 =Participation in Collective Religious Ceremonies and Rituals V581 !Funeral or Burial Ceremonies Held V582 'Intermediate or Local Political Leaders V583 .Leadership Posts in Kinship or Extended family V584 0Participation in Collective Fighting and WarfareV585 9Proportional Contribution of women to overall Subsistence V586 0Relative Time and Effort Expended on SubsistenceV587 ,Community-wide Exclusively Male Works GroupsV588 ,Community-wide Excusively Female Work GroupsV589 -Degree of Segregation in Subsistence Activity V590 .Inheritance of Property of some Economic Value V591 (Ownership or Control of use of DwellingsV592 "Control of the Labor done by Men V593 &Control of the Labor of Men and Female V594 Control of Labor done by Women V595 Domestic Work V596 &(No) Double Standard in Premartial Sex V597 ((No) Double Standard in Extramarital SexV598 %Extramarital Affairs of Married Women V599 Menstrual TaboosV600 $Role of Men and Women in procreationV601 "Sexual Drives and Urges Understood V602 +(No) View that sexual activity is Dangerous V603 $Older generation arranging MarriagesV604 <Voice of the Potential Bride and Groom in Marriage DecisionsV605 Marriage Payments V606 Preferred Marriage formsV607 (No Male) Multiple Spouses V608 (No) Levirate V609 "Relative distances, First marriage V610 #Relative Ease of initiating divorce V611 Relative ease of remarriage V612 Average age at first marriage V613 $Final authority over care of infantsV614 Final authority over up-bringingV615 +Wife to Husband Institutionalized Deference V616 "Preference for Children of One Sex V617 Any Evidence of Infanticide V618 Early training for adult duties V619 Punishment for equal MisbehaviorV620 *Physical punishment of the spouse condoned V621 !(No) View that men Dominate wives V622 0Attendance and Participation Community GatheringV623 1Existence of General female Initiation ceremonies V624 2Status of women has changed in folklore or history V625 AHigh value on males being aggressive, strong, and sexually potent V626 4(No) Belief that women are generally inferior to menV627 (Women more informal influence than normsV628 Property control scale V629 Kin Power Scale V630 Value of life scale V631 Value of labor V632 Domestic authority scaleV633 "Ritualized female solidarity scale V634 Control of sex scaleV635 Ritualized fear scale V636 Joint paricipation scaleV637 Patterns For Grandparents V638 Patterns for Grandchildren V639 Patterns for Uncles V640 Patterns for Aunts V641 /Patterns for Nephews and Nieces (Male Speaking) V642 Patterns for Siblings V643 Patterns for Cross-Cousins V644 Patterns for Siblings-In-LawV645 "Theories of Infection (STDS25.DAT) V646 Theories of Stress V647 Theories of Deterioration V648 Theories of AccidentV649 Theories of FateV650 Theories of Ominous Sensation V651 Theories of Contagion V652 Theories of Mystical RetributionV653 Theories of Soul Loss V654 Theories of Spirit Aggression V655 Theories of Sorcery V656 Theories of Witchcraft V657 YFlexible Marriage Mores (Divorce for both men and women: or mild punishment for adultery) V658 2Females Produce Goods for Nondomestic Distribution V659 *Demand for Female Produce beyond Household V660 0Female Economic COntrol of Products of Own LaborV661 ;Female Political Participation, at least informal influence V662 ,Female Solidarity Groups, formal or informalV663 Female Power Guttman Scale V664 Ideology of Male Toughness V665 Male Segregation: One or more places where males congregate alone, or males occupy a separate part of the household, or there is sharp ceremonial segregation of the sexes V666 +Moderate or Frequent Interpersonal Violence V667 XRape: Incidents reports, or thought of as means of punishment women, or part of ceremonyV668 -At least some Wives taken from Hostile Groups V669 Male Aggression Guttman Scale V670 )Composite of Male Dominance (v663 + v670) V671 Menstrual Taboos (H16) V672 (Male Avoidance of Female Sexuality (ALL)V673 0Sex of Creative Agent, Ancestor, or Culture-HeroV674 #Origin of First Creator or Ancestor V675 Mode of First-Mentioned CreationV676 FCreation Stories (composite of 675 and 656, plus additional societies) V677 Migration V678 Food Stress or Hunger V679 Walfare or Fighting V680 PlowV681 Irrigation V682 Cereal Grains the Principal CropV683 "Roots or Tubers the Principal Crop V684 ,Tree Fruits and Starches the Principal CropsV685 *Large Nomilked Aboriginal Domestic Animals V686 (Large milked Aboriginal Domestic AnimalsV687 DSmall Aboriginal Domestic Animals-excluding dogs, cats, fowl, guineaV688 3Large Domestic Animals, only since European contact V689 3Small Domestic Animals, only since European contact V690 .Large Animals are Hunted and Important to Diet V691 .Small Animals are Hunted and Important to Diet V692 5Intermediate Animals are Hunted and Important to Diet V693 *Frequency of Intercommunity Armed Conflict V694 Male Initiation Ceremonies V695 Male Solidarity V696 Matrilineal Descent V697 Matrilocal ResidenceV698 Perferred Family Form V699 Political Organization V700 Crimes against Person Punished V701 Government full-time BureaucratsV702 Community is part of a Kingdom V703 =Community part of a Kingdom in the past that no longer exists V704 Private PropertyV705 Settlement Type V706 MetalworkingV707 Manufacture of Pottery V708 True WeavingV709 -Social Stratification in the larger societies V710 ,Social Stratification in the Local CommunityV711 :Societal Complexity (Guttman Scale - Freeman & Winch 1957) V712 Institutionalized Envy V713 (Pre-Classical) ReligionV714 Sex Ratio V715 dSystematic Absences of Married Males (Military Service, Labor elsewhere, Extended Trade expeditions)V716 Sex of Coders V717 Number of Sources Consulted V718 Number of Authorities Consulted V719 Total Pages in Sources ConsultedV720 Sex of Authorities V721 Nationality of Authorities V722 Occupation of Authorities V723 (Formal Fieldwork Training of AuthoritiesV724 Knowledge of Native LanguageV725 Total periods of fieldwork V726 Anthropological Present V727 (Importance of Agriculture in SubsistenceV728 -Importance of Animal Husbandry in Subsistence V729 4Importance of Fishing, Shellfishing & Marine HuntingV730 0Importance of Hunting & Gathering in SubsistenceV731 (Importance of Handicrafts, ManufacturingV732 "Importance of Trade in Subsistence V733 (Contribution of the Sexes to AgricultureV734 -Contribution of the Sexes to Animal Husbandry V735 DContribution of the Sexes to Fishing, Shellfishing, & Marine HuntingV736 0Contribution of the Sexes to Hunting & GatheringV737 ?Relative Contribution of the Sexes to Handicrafts & Manufacture V738 +Relative Contribution of the Sexes to Trade V739 Marriage Arrangements V740 Marriage Arrangements (Female) V741 #Widow Remarriage: Choice of Partner V742 ,Time of Mourning Before Remarriage of WidowsV743 Attitude towards DivorceV744 Frequency of DivorceV745 Male Grounds for DivorceV746 Female Grounds for Divorce V747 Honeymoon Customs V748 +Customs surrounding Consumation of Marriage V749 Living Arrangments for NewlywedsV750 "Sleeping Proximity of Man and Wife V751 $Privacy in Sleeping for Man and WifeV752 Husband-Wife Eating ArrangementsV753 $Husband-Wife Leisure Time ActivitiesV754 Wife-BeatingV755 Husband Attends Birth V756 ;(Low) Political Role Differentiation: Full Time Specialists V757 'Political and Religious Differentiation V758 +Local community Leadership Selection: Basis V759 'Perceptions of Political Leaders' Power V760 -Perceptions of Political Leaders' Benevolence V761 Checks on Leader's PowerV762 7(No) Removal of Leaders who are incompetent or disliked V763 #(Low) Leaders Exercise of Authority V764 (Few) Decision Making BodiesV765 :(Low) Impingement of community decisions on people's lives V766 A(Low) Extensiveness of adult participation in community decisions V767 1(No) Conflict (Soc or Pol) in the local community V768 5(No) Conflict between communities of the same society V769 5Conflict management in local community: dominant mode V770 =(No) Use of Physical force by disputants in settling disputes V771 -(No) Mediation/Negociation to settle disputes V772 E(No) Litigation Use of third parties to facilitate dispute settlement V773 (No) Internal Warfare V774 (No) External Warfare V775 2(Low) Compliance of individuals w/ community norms V776 >(Few) Formal sanctions and enforcement for community decisions V777 5(No) Enforcement specialists (police, tax collectors) V778 $(Low) Loyalty to the local communityV779 "(Low) Loyalty to the wider society V780 &(Low) Hostility toward other societies V781 ?(Un)Acceptability of violence toward members of local community V782 X(Uc)Acceptability of violence toward members of same society but outside local communityV783 >(Un)Acceptability of violence toward people in other societies V784 (No) Taxation paid to community V785 4(No) Local Political Fission of Dissatisfied PersonsV786 Adult Mobility V787 "(Low) Contact with other societies V788 &Cross-Cutting Ties between Communities V789 ,Age Organizations Cutting Across CommunitiesV790 0Kinship Organizations Cutting Across CommunitiesV791 #Moieties Cutting Across Communities V792 /Ritual Organizations Cutting Across Communities V793 H(Low) Female Participation in Public Political Arenas, Relative to MalesV794 I(Low) Female Participation in Private Political Arenas, Relative to Males V795 <(Low) Gender differences in political positions of authorityV796 0(No) Separate Female Organizations and PositionsV797 &(Low) Coder Assessment of Data Quality V798 Date of Publication V799 Number of Pages in the Book V800 3Number of Pages Related to Child Training Practices V801 ,Proportion of Book Devoted to Child TrainingV802 Year Fieldwork BeganV803 Total Months of Fieldwork V804 Age of Informants V805 Sex of Informants V806 Number of InformantsV807 CRepeated Observation of Different Families' Socialization Practices V808 ;Use of Multiple Informants to Collect Data on Child Rearing V809 >Use of Tests (e.g., Rorschach, TAT, Sentence Completion, I.Q.) V810 Other Verification Efforts V811 Number of Verification Efforts V812 Language FamiliarityV813 Community Involvement V814 Importance of Agriculture V815 Importance Domes. Anim V816 Importance Fishing V817 Importance Hunting V818 Importance GatheringV819 Importance TradeV820 Principal Subsistence Category V821 *Percent female Contribution to Agriculture V822 /Percent Female Contribution to Domestic Animals V823 &Percent Female Contribution to Fishing V824 &Percent Female Contribution to Hunting V825 (Percent Female Contribution to GatheringV826 *Average Female Contribution to Subsistence V827 $Sexual Expression in Adolescent BoysV828 %Sexual Expression in Adolescent Girls V829 &Sexual Nonrestraint in Adolescent Boys V830 'Sexual Nonrestraint in Adolescent Girls V831 3Boys: Differentiation of Adolescence from Childhood V832 4Girls: Differentiation of Adolescence from ChildhoodV833.1 Latitude in Degrees V833.2 Longitude in DegreesV833 "Subsistence Economy: Dominant Mode V834 $Subsistence Economy: Subsidiary ModeV835 Political Integration V836 Rule of Descent: PrimaryV837 Adequacy of HRAF File V838 Pinpointing DateV840 4Outline of World Cultures Region COde (Murdock 1975)V841 5Outline of World Cultures Country Code (Murdock 1975) V842 :Oultine of World Cultures Ethnic Group COde (Murdock 1975) V843 -Ethnographic Atlas Region Code (Murdock 1962) V844 1Ethnographic Atlas Bub-Region Code (Murdock 1962) V854 GNiche Temperature (Aprroximate) Adapted from William Goode, World Atlas V855 ENiche Rainfall (Approximate) Adapted from WIlliam Goode, World Atlas V856 .Niches Adapted from William Goode, World Atlas V857 KClimate Type- Ordered in terms of Open Access to Rich Ecological Resources V858 +Subsistence Type- Ecological Classification V859 AResources Base- Reclassification of above, as per Paige and Paige V859.1 fMourning Behavoir by Gender- from Variables 27-30, Rosenblatt, Scaled form low to high male emtionally V860 Cultural Basis of Polygyny V861 @Standard Polygamy Code: Whyte, Murdock and Wilson, Murdock AtlasV862 Sororal PolygynyV863 Distance between Co-Wives V864 Rooming Arrangement for Wives V865 Rooming Arrangement for Husband V866 KHigher rates of polygyny for men of wealth, rank, nobility, or higher class V867 !Mutiple wives for skilled hunters V868 ,Mulitiple wives for Leaders, Headman, ChiefsV869 *Mulitple wives for Medicine Men or Shamans NAME  V870 V871 1Percentage of Married Men with More than One Wife V872 /Percentage of Married Women Polygnously Married V873 7Reliability of Data for Percentage Polygynously Married V874 Polygyny Data SourceVA875 Dates for Polygyny Code V875 Dates for Polygyny Code V876 Polygyny Distributions V877 ,Polygyny Guttman Scale I: "Co-Wife Autonomy"V878 Polygyny Guttman Scale II V879 Shaman V880 Shaman/Healer V881 Healer V882 Medium V883 Sorcerer/Witch V884 Priest V885 6Female Contribution to Subsistence: Ethnographic Atlas V886 0Female Contribution to Subsistence: Martin WhyteV887 6Female Contribution to Subsistence: Barry and Schlegel V889 ;Female Contribution to Subsistence: Average of Three Scores V890 ;Female Contribution to Subsistence: Average of Three Scores V888 FFemale Contribution to Subsistence: Maximum Difference of Three Scores V891 Frequency of Internal War V892 %Frequency of External War - Attacking V893 *Frequency of External War - Being Attacked V894 Form of Military Mobilization V895 Decision to Engage in War V896 Commencement of War V897 Conclusion of War V898 Peace Ceremony V899 Military Expectations I V900 Military Expectations IIV901 Casualty Rate V902 Leadership During BattleV903 3Prestige Associated with Being a Soldier or Warrior V904 Cowardice: Defined as V905 pRewards (Special Gifts, Praises, or Ceremonies, not including ritual purification for a man who killed an emeny)V906 CDid Members of the Society Expect Violence to Solve Their Problems? V907 <Value of War: Violence/War Against Non-Members of the GroupV908 YMilitary Success: Is Political Community/Cultural Unit Winning or Losing in the Long Run V909 "Subjugation of Territory or People V910 Collection of Tribute V911 CAcquisition of Land: Fields, Hunting/Fishing Territories, Pastures V912 ;Plunder (Including Captives for Slaves, Hostages, Adoption) V913 6Trophies and Honors (Including Captives for Sacrifice) V914 Revenge V915 Defense V916 HAggressive Defense (Pre-Emptive Attack if Thought Enemy about to Attack)V917 @Historical fram efor pinpointing date where slaveholding presentV918 Manumission of slaves V919 )Large scale slaveholding systems: recency V920 6Large scale slaveholding systems: proportion of slaves V921 CAgricultural Potential 1: Sum of Land Slope, Soils, Climate Scales V922 Land Slope V923 Data Quality: InferencesV924 $Suitability of Soild for AgricultureV925 Data Quality: InferencesV926 Climate V927 Data Quality: Inference V928 EAgricultural Potetial 2: Lowest of Land SLopes, Soils, Climate Scales V929 Average Annual Rainfall V930 Data Quality; InferencesV931 3Female physical appearance during the daily routine V932 1Male physical appearance during the daily routine V933 +Sleeping Arrangements of Adolescent Females V934 Where Spouses Sleep V935 xEating arrangements: the spatial arrangement of the sexes during the main meal of the day, ceremonies or when guests arV936 xIndividual ordeal involved at the onset of the menses. The categories are arranged according to the severity of the ordV937 xSocial celebration involved at the onset of the menses. Arranged according to the amount of celebration and the extent oV938 xThe social signifcance of change in a woman's position with the onset of menstruation. THe categories are ranked accordiV939 xPersonal restrictions or regular menstruation. Ranked according to the degree to which the woman is socially isolated dV940 xSocial Danger: which person would be most harmed if the woman did not adhere to her mentstrual restrictions. Ranked accV941 xPersonal restrictionss on pregnancy. Ranked according to the degree of segregation from social contacts thati is invovleV942 xPurpose of pregnancy restrictions: Ranked according to the extensiveness of the social harm that may result from a womanV943 xSpecial segregation at birth: Location of the woman when she gives birth: where the birth of the first child takes placeV944 >Residence of the new parents at the birth of their first child V945 xPurpose of personal birth restrictions. Each category indicates why the taboos & resrtictions on a woman's personal behV946 xDurarion of personal birht restrictions. Each catergory specifies a period of time after birth before the woman resumes V947 Type of birth celebration V948 !When the birth celebration occurs V949 xParticipants in the birth celebration. The code indicates the most extensive group which participates in the celebrationV950 $Preferred sex and number of childrenV951 Explanation of barrenness V952 Penalties for barrennessV953 OContraception: knowledge and use of means to prevent the conception of children V954 Social Approval for AbortionV955 Rationale for Abortions V956 "Social Disapproval for Infanticide V957 Rationale for Infanticide V958 +Restrictions on the occasion of intercourse V959 Extensions of the incest taboo V960 Violation of the incest taboo V961 Restrictions on Premarital Sex V962 +Violation of restrictions on permarital sex V963 !Restrictions and Extramarital Sex V964 Punishment for extramarital sex V965 'Violation: who is punished for adultery V966 Violation: who punishes adulteryV967 9Age of Woman at Establishment of marriage: first marriage V968 7Age of Man at Establishment of marriage: first marriage V969 ]Choice of spouse: social restrictions which limit an individual's choice of whom he can marry V970 lMarriage proposal: Besides the groom, whose proposal is regarded as most necessary in initiating marriage V971 hConsent to marry: how necessaryis the consent of the prospective wife for marriage arrangment to proceedV972 nConsent to marry: how necessary is the consent of the prospective Husband for marriage arrangements to proceed V973 Degree pf marriage celebration V974 #Type of participants in the wedding V975 +The rights transferred by women at marriage V976 )The rights transferred by men at marriage V977 MFinality: factors that are important for the firm establishment of a marriage V978 CGrounds for divorce: wife's reasons given for dissolving a marriage V979 EGrounds for divorce: husbands reasons given for dissolving a marriage V980 Restrictions on divorce V981 #Rights over offspring after divorce V982 Remarriage after divorceV983 Property exchanges after divorceV984 Remarriage of widowsV985 'Length of time before a widow remarries V986 Importance of Mothers for boys V987 Importance of Mothers for girls V988 GImportance of Mothers for both boys and girls, wothout regard to gender V989 Importance of Fathers for boys V990 Importance of Fathers for girls V991 FImportance of Fathers for both boys and gilrs, wothou regard to gender V992 Importance of Others for boys V993 !Identification of Others for boys V994 Importance of Others for girls V995 "Identification of others for girls V996 EImportance of Siblings (usually oler sisters) for both boys and girls V997 KImportance of Granparents for both boys and girls, without regard to gender V998 FImportance of Others for both boys and girls, without regard to gender V999 EIdentification of Others for boys and girls, without regard to gender V1000 !Enculturarive Continuity for boys V1001 #Incomplete Continuity for boys: age V1002 Enculture Continuity for girls V1003 $Incomplete Continuity for girls: ageV1004 JEnculturative Continuity for both boys and girls without regard for gender V1005 LIncomplete Cintinuity for both boys and girls without regard for gender: ageV1006 'Classification of World System position V1007 Trade and Markets V1008 CroppingV1009 Labor V1010 Labor Recoding V1011 Tool Categories ImportedV1012 Food/Animals Categories ImportedV1013 "Comsumer Goods Categories Imported V1014 Weapons Categories Imported V1015 "Hieratic Goods Categories Exported V1016 Stimulants CAtegories Exported V1017 $Prized Raw Goods Categories ExportedV1018 Local Wares Categories Exported V1019 Consumable Categories Imported V1020 Durable Categories Imported V1021 Consumable Categories Exported V1022 Durable Categories Exported V1023 BThroughputs: Total number of categories both imported and exported V1025 Salves V1026 Small Animals V1027 Large Animals V1028 Meat/Dairy, Furs, Skins V1029 Cereal grains, cash crops V1030 Salt, SpicesV1031 "Wood, Fuel, Construction Materials V1032 OresV1033 Agricultural Input V1034 Prestige Goods V1035 Craft Goods V1036 Alcohol V1037 Stimulants V1038 "Pots, Beads, Cooking Utensils, etc V1039 Books, Magazines, NewspapersV1040 Clothing, Cloth, Blankets V1042 Radios, Lamps, Electricity V1043 Metal Tools V1044 Weapons, Ammunition V1045 Tractors, Pumps, Machines V1046 Slaves V1047 Small Animals V1048 Large Animals V1049 Meat/dairy, furs, skins V1050 Cereal grains V1051 Salt, spicesV1052 "Wood, fuel, construction materials V1053 OresV1054 Agricultural Inputs V1055 prestige Goods V1056 Craft Goods V1057 Alcohol V1058 Stimulants V1059 Pots, Beads, Cooking utensils V1060 Books, Magazines, NewspapersV1061 Clothing, Cloth, Blankets V1062 Bicycles, cars, power boats V1063 Radios, Lamps, Electricity V1064 Metal Tools, traps V1065 Weapons, Ammunition V1066 Tractors, pumps, machines V1072 Date of Observation V1073 (Change in 100 years prior to observationV1074 4Extent of Change in Subsistence or Supportive SystemV1075 `Agricultural Intensification: Increase in inputs without increasing LAnd area of Food ProductionV1076 Non-agricultural IntensificationV1077 New Crops V1078 New Animals V1079 Change in Settlement Patterns V1080 BExpansions of Land utilized in Subsistence or Supportive Practices V1081 Major Loss of Subsistence Mode V1082 Wage Labor Introduced V1083 Wage Labor IncreasedV1084 Introduction to Trade V1085 Trade Increased NUMBER V1086 Date of Observation V1087 Political Entities ConqueredV1088 'Freq of expansions into other societies V1089 &Distance to furthest society conquored V1090 -Society was Conquored, Colonized or Displaced V1091 $Freq of expansions into this societyV1092 &Catastropic sifts causing depopulation V1093 @# years prior to observation for beginning of problem(s) causingV1094 5# years prior to observation for ending of problem(s) V1095 Percentage of Population Lost V1096 !Percentage of Population Recovery V1097 !Population at date of observation V1100 /Societal migration or relocation past 100 years V1101 /Societal migration or relocation past 500 years V1102 Time in new location to present V1103 Distance migrated V1104 "Reason for migration or relocation V1105 ?Effects of relocation on (a) trade (b) gender (c) soc str, land V1106 Reservation or reserve status V1107 5Society unintentionally caught up in state level wars V1108 -# years before now when warfare first stopped V1110 !Restrictions on war in effect now V1111 .Effects of above restrictions on men and women   V1112 Number of turbulent changes V1116 Warfare Mortality V1117 Internal WarfareV1118 #Pacification by Date of Observation V1119 External War Only V1120 Some External War V1121 Variable Not Identified V1122 log10 of Total Population V1123 Major Agricultural Staple V1124 ,Agricultural Staple Data Quality: InferencesV1125 Second Agricultural Staple V1126 3Second Agricultural Staple Data Quality: Inferences V1127 $Crop Type Plow-Positive or -NegativeV1128 Cropping Index V1129 'Cropping Index Data Quality: Inferences V1130 Population Density V1131 +Population Density Data Quality: Inferences V1132 Political Intergration V1133 Maximum Harem Size V1134 9Despotic Bias in Conflict Resolution: Degree of Despotism V1135 Jurisdictional Perquisites V1136 $Infidelity: Adultery- Divorce CausesV1137 ,Infidelity: Lack of Virginity-Divorce CausesV1138 #Infidelity: Polygamy-Divorce Causes V1139 2Infidelity: Cruelty or Maltreatment-Divorce Causes V1140 )Disobedience or Disrespect-Divorce Causes V1141 )Infidelity: Repressiveness-Divorce Causes V1142 %Infidelity: Jealously- Divorce Causes V1143 (Infidelity: Another lover-Divorce CausesV1144 %Infertility: Sterility-Divorce Causes V1145 *Infertility: Sexual Neglect-Divorce Causes V1146 0Inferltility: Refusal to have Sex-Divorce CausesV1147 -Infertility: Death of Children-Divorce Causes V1148 5Infertility: Absence of Male Children- Divorce Causes V1149 >Infertility: Exchange wife has too few Children-Divorce Causes V1150 >Infertility: Exchange wife has too few children-Divorce Causes V1151 *Personality: Mutual Consent- Divorce Cause V1152 ,Personality: Displeasingness- Divorce CausesV1153 =Personlaity: Quarrelsomeness or Talkativeness- Divorce Causes V1154 %Personality:Bad Temper-Divorce Causes V1155 5Personality:Other Personality Problems-Divorce Causes V1156 Economic:Laziness-Divorce CausesV1157 *Econimic:Inadequate Support-Divorce Causes V1158 #Economic:Inadequate- Divorce Causes V1159 'Econimc:Inadequate Food- Divorce Causes V1160 ,Economic: Inadequate Clothing-Divorce CausesV1161 5Economic: Inadequate Food Preparation- Divorce Causes V1162 4Econimic:Inadequately serving Spouse- Divorce CausesV1163 1Econimic: Other Economic Problems- Divorce Causes V1164 (In-LAw Conflicts: Conflicts with in-lawsV1165 /In-Law Conlficts: Inadequaltely serving in-laws V1166 /In-Law Conflicts: Bridewealth or Dowry Disputes V1167 7In-LAw Conflicts: Disrespect for in-Laws-Divorce Causes V1168 2In-Law Conflicts: Spouse Favors Kin-Divorce Causes V1169 6In-LAw Conflicts: Other In-Law Problems-Divorce Causes V1170 -Ritual: Witchcraft or Sorcery- Divorce Causes V1171 #Ritual:Broken Taboo: Divorce Causes V1172 (Ritual: Bad Dream of Omen-Divorce CausesV1173 -Ritual: Other Ritual Problems: Divorce Causes V1174 $Absence or Desertion: Divorce CausesV1175 Health: Divorce Causes V1176 Politics: Theft- Divorce Causes V1177 5Politics: Confiction or Incarceration- Divorce Causes V1178 2Politics: Other Political Problems- Divorce Causes V1188 Evil Eye Scaled Rating V1189 Evil Eye Belief V1190 SororateV1191 LevirateV1192 Structurally Opposed Kin Groups V1193 %Exogamous Nonlocalized Descent Groups V1194 Indirect Exchange of Wives V1195 Bridewealth V1196 Avoidance: Wife's Brother Wife V1197 Avoidance: Mother-in-LawV1198 Avoidance: Wife's FatherV1199 Avoidance: Wife's Brother V1200 $Avoidance: Wife's Brother's DaughterV1201 Avoidance: Wife's SisterV1202 Avoidance: Wife's SisterV1203 #Avoidance: Wife's Sister's Daughter V1204 Avoidance: FAther-in-LawV1205 Avoidance: Husband's Mother V1206 Avoidance: Husband's Sister V1207 #Avoidance: Husband's Sister Husband V1208 Avoidance: Husband's BrotherV1209 Husband's Brother V1210 "Avoidance: Husband's Brother's son V1211 Avoidance: Brother-Sister V1212 Avoidance: Brother-Sister V1213 Avoidance: HAlf-Sibling V1214 Avoidance: Half-sibling V1215 'Avoidance: Matrilateral Parallel Cousin V1216 'Avoidance: Matrilateral Parallel Cousin V1217 'Avoidance: Patrilateral Parallel Cousin V1218 'Avoidance: Patrilateral Parallel Cousin V1219 $Avoidance: Patrilateral Cross-CousinV1220 $Avoidance: Matrilateral Cross-CousinV1221 Aviodance: Male Cross-Cousins V1222 Avoidance: Female Cross-Cousins V1223 Avoidance: Paternal Aunt Nephew V1224 Avoidance: Maternal Uncle Neice V1225 Aviodance: Maternal Uncle's WifeV1226 Kin Behavior: Sister and BrotherV1227 2Kin Behavior: Wife's Mother and Daughter's Husband V1228 -Kin Behavior: Son's Wife and Husband's Father V1229 @Kin Behavior: Mother's Brother's Wife and Husband's Sister's SonV1230 FKin Behavior: Wife's Brother's Daughter and Father's Sister's Husband V1231 CKin Behavior: Mother's Brother's Daughter and Father's Sister's Son V1232 CKin Behavior: Father's Sister's Daughter and Mother's Brother's Son V1233 @Kin Behavior: Elder Brother's Wife and Husband's Younger BrotherV1234 AKin Behavior: Younger Brother's Wife and Husband's Elder Brother V1235 >Kin Behavior: Wife's Elder Sister and Younger Sister's Husband V1236 >Kin Behavior: Wife's Younger Sister and Elder Sister's Husband V1237 @Kin Behavior: Wife's Brother's Wife and Husband's Sister HusbandV1248 +Female Body Type Considered Most Attractive V1249 4Exposure of Adolescent Girls to Male Sexual AdvancesV1250 9Consequences For Adolescent girls Pegnant Before Marriage V1251 &Degree of Public Awareness of Menarche V1253 Leishmanias V1254 TrypanosomesV1255 Malaria V1256 SchistosomesV1257 FilariaeV1258 Spirochetes V1259 Leprosy V1260 Total Pathogen Stress V1261 4Ordinary Nutional Conditions and Endemic Starvation V1262 #Occuurence of Short-Term Starvation V1263 Occurence of Seasonal StarvationV1264 .Temporal Control Codes for Seasonal Starvation V1265 Occurence of Famine V1266 2Temporal Control Codes for the Occurence of Famine V1267 Severity of Famine V1268 Persistence of Famine V1269 Recurrence of FamineV1270 Contingency of Famine V1271 "Adult LAnd Clearance--Primary Crop V1272 $Adult Soil Preparation--Primary CropV1273 Adult Planting--Primary CropV1274 !Adult Crop Tending-- Primary Crop V1275 Adult Harvesting--Primary Crop V1276 2Adult Agricultural Task Unspecified-- Primary Crop V1277 -Adult Other Agricultural Chores--Primary Crop V1278 "Child Land Clearance--Primary Crop V1279 $Child Soil Preparation--Primary CropV1280 Child Planting--Primary CropV1281 Child Crop tending--Primary CropV1282 Child Harvesting--Primary Crop V1283 1Child Agricultural Task Unspecified--Primary Crop V1284 -Child Other Agricultural Chores--Primary Crop V1285 )Children Under 6 Clear Land--Primary Crop V1286 /Children Under 6 Soil Preparation--Primary Crop V1287 'Children Under 6 Planting--Primary Crop V1288 +Children Under 6 Crop Tending--Primary Crop V1289 )Children Under 6 Harvesting--Primary Crop V1290 =Children Under 6 Agricultural Tasks Unspecified--Primary Crop V1291 8Children under 6 other Agricultural Chores--Primary CropV1292 )Children 6 to 10 Clear Land--Primary Crop V1293 /Children 6 to 10 Soil Preparation--Primary Crop V1294 'Children 6 to 10 Planting--Primary Crop V1295 +Children 6 to 10 Crop Tending--Primary Crop V1296 )Children 6 to 10 Harvesting--Primary Crop V1297 =Children 6 to 10 Agricultural Tasks Unspecified--Primary Crop V1298 8Children 6 to 10 Other Agricultural Chores--Primary CropV1299 -Children Over 10 Clearance Land--Primary Crop V1300 /Children Over 10 Soil Preparation--Primary Crop V1301 'Children Over 10 Planting--Primary Crop V1302 +Children Over 10 Crop Tending--Primary Crop V1303 )Children Over 10 Harvesting--Primary Crop V1304 =Children Over 10 Agricultural Tasks Unspecified--Primary Crop V1305 8Children Over 10 Other Agricultural Chores--Primary CropV1306 %Uses of Fruits of Labor--Primary Crop V1307 'Children Clear Land Alone--Primary Crop V1308 )Children Prepare Soil Alone--Primary Crop V1309 "Children Plant Alone--Primary Crop V1310 'Children Tend Crops Alone--Primary Crop V1311 $Children Harvest Alone--Primary CropV1312 =Children do Unspecified Agricultural Tasks Alone-Primary Crop V1313 :Children do other Agricultural Chores Alone--Primary Crop V1314 1Children Clear Land with Other Kids--Primary Crop V1315 3Children Prepare Soil with other Kids--Primary Crop V1316 ,Children Plant with other Kids--Primary CropV1317 1Children Tend Crops with other Kids--Primary Crop V1318 .Children Harvest with other Kids--Primary Crop V1319 <Children do Unspecified Chores with other Kids--Primary CropV1320 CChildren do Other Agricultural Chores with other Kids--Primary Crop V1321 -Children Clear Land with Adults--Primary Crop V1322 0Children Prepare Soil with Adults--Primary Crop V1323 (Children Plant woth Adults--Primary CropV1324 -Children tend Crops with Adults--Primary Crop V1325 *Children Harvest with Adults--Priamry Crop V1326 DChildren do Unspecified agricultural tasks with Adults--Primary CropV1327 >Children do other Agriculural Chores with Adults--Primary Crop V1328 (Importance of Boy Clearing--Primary CropV1329 .Importance of Boy Preparing Soil--Primary Crop V1330 (Importance of Boy Planting--Primary CropV1331 ,Importance of Boy tending Crops-Primary CropV1332 *Importance of Boy Harvesting--Primary Crop V1333 =Importance of Boy Unspecified Agricultural Tasks-Primary Crop V1334 3Importance of Boy Agricultural Chores--Primary Crop V1335 )Importance of Girl Clearing--Primary Crop V1336 /Importance of Girl Preparing Soil--Primary Crop V1337 )Importance of Girl Planting--Primary Crop V1338 .Importance of Girl Tending Crops--Primary Crop V1339 +Importance of Gilr Harvesting--Primary Crop V1340 ?Importance of Girl Unsoecified Agricultural Tasks--Priamry Crop V1341 :Importance of Gilr other Agricultural Chores--Primary Crop V1342 /Adult Preference in Land Clearing--Primary Crop V1343 1Adult Prefernce in Soil Preparation--Primary Crop V1344 *Adult Preference in Planting--Primary Crop V1345 .Adult Preference in Crop Tending--Primary Crop V1346 ,Adult Preference in Harvesting--Primary CropV1347 ?Adult Preference in Unspecified Agriculture Tasks--Primary Crop V1348 ;Adult Preference in other Agricultural Chores--Primary Crop V1349 Primary Crop Name V1350 Other Primary Crop Name V1351 irrigation Used--Primary Crop V1352 Hand Plow Used--Primary CropV1353 Animal Plow Used--Primary Crop V1354 &Terraces adb Mounds Used--Primary Crop V1355 Fences Used--Primary Crop V1356 )Green Manure and Mulch Used--Primary Crop V1357 Animal Manure Used--Primary CropV1358 Human Manure Used--Primary Crop V1359 Pesticides Used--Primary Crop V1360 Extent of Weeding--Primary Crop V1361 Crop Supervision--Primary Crop V1362 !Planting Techniques--Primary Crop V1363 'Shortest Length of Fallow--Primary Crop V1364 'Soil Treatment/Sands Used--Primary Crop V1365 'Chemical Fertilizers Used--Primary Crop V1366 'Stakes and Trellises Used--Primary Crop V1367 $Adult Land Clearance--Secondary CropV1368 &Adult Soil Preparation--Secondary Crop V1369 Adult Planting--Secondary Crop V1370 "Adult Crop Tending--Secondary Crop V1371 Adult Harvesting--Secondary CropV1372 3Adult Agricultural Task Unspecified--Secondary Crop V1373 /Adult other Agricultural Chores--Secondary Crop V1374 $Child Land Clearance--Secondary CropV1375 &Child Soil Preparation--Secondary Crop V1376 Child Planting--Secondary Crop V1377 "Child Crop Tending--Secondary Crop V1378 %Child Crop Harvesting--Secondary Crop V1379 2Child Agricltural Task Unspecified--Secondary Crop V1380 /Child other Agricultural Chores--Secondary Crop V1381 +Children Under 6 Clear Land--Secondary Crop V1382 1Children Under 6 Soil Preparation--Secondary Crop V1383 )Children Under 6 Planting--Secondary Crop V1384 .Children Under 6 Crop Tending-- Secondary Crop V1385 +Children Under 6 Harvesting--Secondary Crop V1386 ?Children Under 6 Agricultural Tasks Unspecified--Secondary Crop V1387 :Children Under 6 other Agricultural Chores--Secondary Crop V1388 +Children 6 to 10 Clear Land--Secondary Crop V1389 1Children 6 to 10 Soil Preparation--Secondary Crop V1390 )Children 6 to 10 Planting--Secondary Crop V1391 .Children 6 ro 10 Crop Tending-- Secondary Crop V1392 +Children 6 to 10 Harvesting--Secondary Crop V1393 ?Children 6 to 10 Agricultural Tasks Inspecified--Secondary Crop V1394 :Children 6 to 10 Other Agricultural Chores--Secondary Crop V1395 +Children Over 10 Clear Land--Secondary Crop V1396 1Children over 10 Soil Prepararion--Secondary Crop V1397 )Children over 10 Planting--Secondary Crop V1398 -Children over 10 Crop Tending--Secondary Crop V1399 +Children over 10 Harvesting--Secondary Crop V1400 @Children over 10 Agricultural Tasks Unspeocified--Secondary CropV1401 :Children over 10 other Agricultural Chores--Secondary Crop V1402 'Uses of Fruits of Labor--Secondary Crop V1403 )Children Clear Land Alone--Secondary Crop V1404 +Children Prepare Soil Alone--Secondary Crop V1405 $Children Plant Alone--Secondary CropV1406 )Children Tend Crops Alone--Secondary Crop V1407 &Children Harvest Alone--Secondary Crop V1408 @Children do Unspecified Agricultural Tasks Alone--Secondary CropV1409 ;Children do other Agricultural Chores Alone--Secondary Crop V1410 3Children Clear Land with other Kids--Secondary Crop V1411 .Children Plant with other Kids--Secondary Crop V1412 /Children Plant with other Kids--Secondary Crop V1413 3Children Tend Crops with other Kids--Secondary Crop V1414 0Children Harvest with other Kids--Secondary CropV1415 >Children do Unspecified CHores with other Kids--Secondary Crop V1416 EChildren do other Agricultural Chores with other Kids--Secondary Crop V1417 /Children Clear Land with Adults--Secondary Crop V1418 1Children Prepare Soil with Adults--Secondary Crop V1419 *Children Plant with Adults--Secondary Crop V1420 /CHildren Tend Crops with Adults--Secondary Crop V1421 ,Children Harvest with Adults--Secondary CropV1422 BChildren do other Agricultural Chores with Adults--Secondary Crop V1423 AChildren do other Agricultural CHores with Adults--Secondary Crop V1424 *Importance of Boy Clearing--Secondary Crop V1425 0Importance of Boy Preparing Soil--Secondary CropV1426 *Importance of Boy Planting--Secondary Crop V1427 /Importance of Boy Tending Crops--Secondary Crop V1428 ,Importance of Boy Harvesting--Secondary CropV1429 @Importance of Boy Unspeicfied Agricultural Tasks--Secondary CropV1430 ;Importance of Boy other Agricultural Chores--Secondary Crop V1431 +Importance of Girl Clearing--Secondary Crop V1432 1Importance of Girl Preparing Soil--Seocndary Crop V1433 +Importance of Girl Planting--Secondary Crop V1434 0Importance of Girl Tending Crops--Secondary CropV1435 -Importance of Girl Harvesting--Secondary Crop V1436 DImportance of Girls Unspeicified Agricultural Tasks--Seconodary CropV1437 <Importance of Girl other Agricultural Chores--Secondary CropV1438 1Adult Preference in Land Clearing--Secondary Crop V1439 4Adult Preference in Soil Prepararion--Secondary CropV1440 +Adult Preferencein Planting--Secondary Crop V1441 0Adult Preference in Crop Tending--Secondary CropV1442 .Adult Preference in Harvesting--Secondary Crop V1443 CAdult Preference in Unspecified Agricultural Tasks---Secondary Crop V1444 =Adult Prefernece in other Agricultural Chores--Secondary Crop V1445 Secondary Crop Name V1446 Other Secondary Crop Name V1447 Irrigation Used--Secondary Crop V1448 Hand Plow Used--Secondary Crop V1449 Animal Plow Used--Secondary CropV1450 (Terraces and Mounds Used--Secondary CropV1451 Fences Used--Secondary Crop V1452 *Green Manure and Mulch Used-Secondary Crop V1453 "Animal Manure Used--Secondary Crop V1454 !Human Manure Used--Secondary Crop V1455 Pesticides Used--Secondary Crop V1456 !Extent of Weeding--Secondary Crop V1457 Crop Supervision--Secndary Crop V1458 #Planting Techniques--Secondary Crop V1459 )Shortest Length of Fallow--Secondary Crop V1460 *Soil Treatments/Sands Used--Secondary Crop V1461 )Chemical Fertilizers Used--Secondary Crop V1462 )Stakes and Trellises Used--Secondary Crop V1463 Adults Herd Small Animals V1464 Adults care for Small Animals V1465 Children Herd Small Animals V1466 Children Care for Small Animals V1467 #Children Under 6 Herd Small Animals V1468 $Children 6 ato 10 Herd Small AnimalsV1469 #Children over 10 Herd Small Animals V1470 (Children under 10 care for Small AnimalsV1471 'Children 6 to 10 Care for Small Animals V1472 'Children over 10 care for small Animals V1473 Product use of Small AnimalsV1474 !Children Herd Small Animals Alone V1475 )CHildren Herd Small Animals with Children V1476 'Children Herd Small Animals with Adults V1477 %Children Care for Small Animals Alone V1478 -Children Care for Small Animals with Children V1479 +Children Care for Small Animals with Adults V1480 'Importance of Boy Herding Small Animals V1481 (Importance of Girl Herding Small AnimalsV1482 (Importance of Girl Herding Small AnimalsV1483 )Importance of Girl care for Small Animals V1484 )Adult Preference in Herding Small Animals V1485 ,Adult Preference in Caring for Small AnimalsV1486 Goats Present V1487 Sheep Present V1488 Pigs PresentV1489 Rabbits and Guinena Pigs PresentV1490 Sled and Pack Dogs Presnet V1491 Adults Herd Large Animals V1492 Adults Care for Large Animals V1493 Children Herd Large Animals V1494 Children Care for Large Animals V1495 $Children Under 6 Herd Large Animals V1496 $Children 6 to 10 Herd Large Animals V1497 $Children Over 10 Herd Large Animals V1498 'Children Under 6 Care for Large Animals V1499 (Children 6 to 10 Care for Large Animals V1500 (Children Over 10 Care for Large Animals V1501 Product Use of Large Animasl V1502 "Children Herd Large Animals Alone V1503 )Children Herd Large Animals with Children V1504 (Children Herd Large Animasl with Adults V1505 &Children Care for Large Animals Alone V1506 .Children Care for Large Animals with Children V1507 +Children Care for Large Animals with Adults V1508 (Importance of Boy Herding Large Animals V1509 )Importance of Girl Herding Large Animals V1510 )Importance of Boy Care for Large Animals V1511 *Importance of Girl Care for Large Animals V1512 *Adult Preference in Herding Large Animals V1513 -Adult Preference in Caring for Large Animals V1514 Cattle Present V1515 Horses Present V1516 Donkeys/Mules Present V1517 Camels Present V1518 Reindeer Present V1519 Yaks Present V1520 Buffalo Present V1521 Llama Present V1522 Adults do Wage LaborV1523 Children do Wage LAbor V1524 Children Under 6 do Wage Labor V1525 Children 6 to 10 do Wage Labor V1526 Children Over 10 do Wage Labor V1527 &Who Controls the Earningof Wage Labor? V1528 Children Do Wage Labor AloneV1529 $Children fo Wage Labor with ChildrenV1530 "CHildren do Wage Labor with Adults V1531 "Importance of Boy doing Wage Labor V1532 #Importance of Girl Doing Wage Labor V1533 Adult Preference Wage Labor V1534 Adults TradeV1535 Children Trade V1536 Children Under 6 Trade V1537 Children 6 to 10 Trade V1538 Children over 10 Trade V1539 !Who Contrlos the Cash from Trade? V1540 Children Trade AloneV1541 'Children Trade Alongside other Children V1542 Children Trade Alongside Adults V1543 Importance of Boy Trading V1544 Importance of Girl Trading V1545 Adult Preference in Trade V1546 Adults Gather V1547 Children Gather V1548 Children Under 6 Gather V1549 Children 6 to 10 Gather V1550 Children Over 10 Gather V1551 'Who Controls the Products of Gathering? V1552 Children Gather Alone V1553 Children Gather with Children V1554 Children Gather with Adults V1555 Importance of Girl GatheringV1556 Importance of Girl GatheringV1557 Adult Preference Gathering V1592 Adults Cook V1593 Children Cook V1594 Children Under 6 Cook V1595 Children 6 to 10 Cook V1596 Children Over 10 Cook V1597 &Who Controls the Products of Cooking? V1598 Children Cook Alone V1599 Children Cook with Children V1600 Children Cook with Adults V1601 Importance of Boy Cooking V1602 Importance of Girl Cooking V1603 Adult Preference Cooking V1604 Adults Tend Fires V1605 Children Tend Fires V1606 Children Under 6 Tend Fires V1607 Children 6 to 10 Tend Fires V1608 Children Over 10 Tend Fires V1609 Children Tend Fires Alone V1610 .Children Tend Fires Along With Other Children V1611 Children Tend Fires With Adults V1612 Importance of Boy Tending Fires V1613 Importance fo Girl Tending FiresV1614 !Adult Preference in Tending FIres V1615 Adults Gather Fuel V1616 Children Gather Fuel V1617 Children Under 6 Gather Fuel V1618 Children 6 TO 10 Gather FuelV1619 Children Over 10 Gather FuelV1620 Children Gather Fuel Alone V1621 #Children Gather Fuel With Children V1622 Children Gather Fuel with AdultsV1623 !Importance of Boy Gathering Fuel V1624 "Importance of Girl Gathering Fuel V1625 Adult Preference Fuel Gathering V1626 Adults Carry Burdens V1627 Children Carry Burdens V1628 Children Under 6 Carry Burdens V1629 Children 6 to 10 Carry Burdens V1630 Children Over 10 Carry Burdens V1631 Children Carry Burdens Alone V1632 1Children Carry Burdens Along With Other Children V1633 "Children Carry Burdens With Adults V1634 $Importance of Girl Carrying Burdens V1635 $Importance of Girl Carrying Burdens V1636 &Adult Preference in Carrying Burdens V1637 Adults Carry Water V1638 Children Carry Water V1639 Children Under 6 Carry WaterV1640 Children 6 to 10 Carry Water V1641 Children Over 10 Carry Water V1642 Children Carry Water Alone V1643 /Children Carry Water Alone with other Children V1644 !Children Carry Water with Adults V1645 !Importance of Boy Carrying Water V1646 "Importance of Girls Carrying Water V1647 Adult Preference in Carry Water V1648 .Overall Frequency of Warfare (resolved rating) V@V1649 /Frequency of Internal Warfare (resolved rating) V@V1650 /Frequency of External Warfare (resolved rating) V@V1651 &Reliability of Overall Warfare Ratings V1652 'Reliability of Internal Warfare Ratings V1653 'Reliability of External Warfare Ratings V1654 Pacification@"@V1655 +Outcomes Regarding Land in Internal Warfare V@X@V1656 +Outcomes Regarding Land in External Warfare V@X@V1657 Outcomes Regarding Land in War: Overall-combined scale scores from Vars 1655 and 1656 according to the rules following this section:V1658 8Outcomes Regarding Nonland Resources in Internal WarfareV@X@V1659 8Outcomes Regarding Nonland Resources in External Warfare(@V@V1660 Outcomes Regarding Nonland Resources in War: Overall - combined scale scores form Vars 1658 and 1659 according to the rules following this section: V1661 ?Reliability of Outcomes of Internal Warfare Ratings (Var. 1655) V1662 >Reliability of Outcomes of External Warfare Ratings (Var.1656) V1663 ?Reliability of Outcomes of Internal Warfare Ratings (Var. 1658) V1664 >Reliability of Outcomes of External Warfare Ratings (Var.1659) V1665 !Individual Aggression - Homicide V@V1666 Individual Aggression - Assault V@V1667 Individual Aggression - Theft V@V1668 Individual Aggression - TrespassV@X@V1669 2Individual Aggression - Suicide (resolved ratings) V@V1670 AReliability of Individual Aggression Ratings-Homicide (Var. 1665) V1671 @Reliability of Individual Aggression Ratings-Assault (Var. 1666)V1672 =Reliability of Individual Aggression Ratings-Theft (Var.1667) V1673 AReliability of Individual Aggression Ratings-Trespass (Var. 1668) V1674 @Reliability of Individual Aggression Ratings-Suicide (Var. 1669)V1675 Socially Organized Homicide V@V1676 Socially Organized Assault @V1677 Socially Organized Theft @V1678 Socially Organized Trespass @"@V1679 >Reliability of Socially Organized Homicide Ratings (Var. 1675) V1680 =Reliability of Socially Organized Assault Ratings (Var. 1676) V1681 ;Reliability of Socially Organized Theft Ratings (Var. 1677) V1682 =Reliability of Socially Organized Trespass Ratings (Var.1678) V1683 "Threat of Famine (resolved rating) @V1684 #Threat of Weather or Pest Disasters @V1685 +Chronic Resource Problems (resolved rating) @V1686 2Reliability of Threat of Famine Ratings (Var.1683) V1687 FReliability of Threat of Natural and Pest Disaster Ratings (Var. 1684) V1688 3Reliability of Chronic Scarcity Ratings (Var. 1685) V1689 Sex Ratio (males/females * 1000)V1691 Sex Ratio Unit V1692 Scarification 1: Males V1693 Scarification 2: FemalesV1694 General Scarification: MalesV1695 General Scarification: Females V1696 Biome V1697 Wound Opportunistic Typhus V1698 Wound Opportunistic Bejel V1699 Wound Opportunistic Pinta V1700 Wound Opportunistic YawsV1701 Wound Opportunistic Leprosy V1702 Wound Opportunistic Leishmania V1703 Wound Opportunistic Spirochetes V1704 Tick Vector Typus V1705 Tick Vector Spirochetes V1706 TrypanosomasV1707 Malaria V1708 SchistosomesV1709 FilariaeV1710 )Person(s) Infants and Children Sleep With V1711 Where Adolescents Sleep V1712 -Sex Segregation in Sleeping Areas of Children V1713 :Sex Segregation in Sleeping Areas of Adolescents and Teens V1714 First Two Digits of Focus Date V1715 Second Two Digits of Focus Date V1716 Primary Source of Subsistence V1717 Secondary Source of Subsistence V1718 Sahring of food V1719 %Periodical Variation of Food Scarcity V1720 Causes of Land Shortage V1721 Number of Rich people (wealthy) V1722 Sources of Wealth V1723 Number of Poor V1724 Number of Dispossessed V1725 -Possibility of Peaceful Territorial Expansion V1726 Communality of Land V1727 >Resource Acquisition as Motive for Violent Conflict Management V1728 =Rich, Poor, or Dispossessed as One Party in Violent Conflicts V1729 )Presence of an Overarching Political Unit V1730 OAdministrative Integration of Local Community Within Overarching Political Unit V1731 DPower Participation of Local Elite Within Overarching Political UnitV1732 Presence of Wage Labor V1733 %Market Exchage Within Local Community V1734 *Market Exchange Outside of Local Community V1735 RRelationship Between Production for Subsistence and Production for Market Exchange V1736 Tribute, Taxation, ExpropriationV1737 7Extent of Burden Caused by Tribute Payments or Taxation V1738 3Presence of Formal Education Within Local Community V1739 ;Types of Violence Against Overarching Political Institution V1740 Levels of Political Hierarchy V1741 JOverarching Formal Jurisdiction within Unit of Maximal Political Authority V1742 ASelection of Officials at the Lowest Level of Political Hierarchy V1743 Sanctions V1744 WLower Level participation in Decision Making of the Unit of Maximal Political Authority V1745 Religio-political Overlap V1746 Sources of Legitimation of PowerV1747 BFrequency of External Warfare: Unit of Maximal Political Authority V1748 Frequency of Internal Warfare V1749 uFrequency of Internal Warfare Involving Non-territorially Organized Groups within Unit of Maximal Political Authority V1750 EFrequency of Violent Conflict Between Groups within Local Communities V1751 Social Stratification V1752 8Grooms Dependency on Relatives for Marriage TransactionsV1753 Unilineal Descent V1754 #Size of Maximal Effective Kin Group V1755 1Local Distribution of Maximal Effective Kin Group V1756 Size of Local Community V1757 QFrequency of Violent Conflict Involving at Least One Maximal Effective Kin Group V1758 DFrequency of Violent Conflict Involving at Least One Local CommunityV1759 Affection During Early ChildhoodV1760 HFrequency of Interactions Between Boys (early childhood) and Male AdultsV1761 0Inculcation of Children's Trust in Other PersonsV1762 WPositive Reinforcement of Children's Willingness to Share, Give, and Help (generosity) V1763 Emphasis on Honesty V1764 QReaction of Socializing Agents Towards Violent Behavior of Boys in Late Childhood V1765 -Emphasis on Courage of Boys in Late Childhood V1766 -Corporal Punishment of Boys in Late Childhood V1767 Ideology of Male SuperiorityV1768 EAttitude Towards Physical Violence Against Members of Local Community V1769 jAttitude Towards Physical Violence Against Members of Same Ethnic Group, not Restricted to Local Community V1770 IAttitude Towards Physical Violence Against Members of Other Ethnic Groups V1771 Loyalty Within Ethnic GroupsV1772 %Hostility Towards Other Ethnic Groups V1773 Prestige of WarriorsV1774 Revenge Related Norms V1775 &Reglementation of Intraethnic Violence V1776 !Frequency of Intraethnic Violence V1777 !Intensity of Intraethnic Violence V1778 !Frequency of Intraethnic Violence V1779 Weapons Used in Warfare V1780 .Defensive (projective) Weapons Used in Warfare OWC Outline of World Cultures NumberSCCS %Standard Cross-Cultural Sample Number SOCIETY Society Name  V1781 Gossip on Adultery V1782 Gossip on Boasting V1783 Gossip on Bride Price V1784 Gossip on Cattle/Livestock V1785 Gossip on Dowry PaymentsV1786 Gossip on Drinking V1787 Gossip on FamilyV1788 Gossip on Farming V1789 &Gossip on Government, Colonial Affairs V1790 Gossip on Hunting V1791 Gossip on Inheritance V1792 Gossip on Laziness V1793 Gossip on Men V1794 Gossip on Murder, Assault V1795 Gossip on Neighbors V1796 Gossip on Politics V1797 Gossip on Scandal V1798 Gossip on Sex, Sexual JokingV1799 Gossip on Social ControlV1800 Gossip on Socializing, News V1801 Gossip on Wife Beating V1802 Gossip on Women V1803 Gossip on Marriage V1804 Gossip on Religion V1805 #Importance of Gossip in the Society FACT_1 GNews & General Gossip Scale (Men, Neighbors, Socializing & News, Women) FACT_2 0Political Gossip Scale (Family, Govt., Politics)FACT_3 AMachismo Gossip Scale (Boasting, Hunting, Laziness, Wife Beating) FACT_4 (Sex & Scandals Scale (Adultery, Scandal)FACT_5 4Drinking & Murder Scale (Drinking, Murder & Assault)FACT_6 3Marriage Payments Gossip Scale (Bride Price, Dowry) FACT_7 3Farming & Religion Gossip Scale (Farming, Religion) FACT_8 1Cattle & Marriage Gossip Scale (Cattle, Marriage) V1806TRAdomestic products V1807TRA wage labor V1808TRAmonetary system V1809TECweapons V1810TEC3Minor Technological developments house construction V1811TEC Major techno factories, mining, V1812AGRcrops V1813AGR$agricultural improvement,irrigation,V1814AGR livestock V1815TRA)Mechsnical transport auto,railroad, buses V1816TRAwater transport V1817TRAroads, highways V1818GOV%New positions as government officials V1819GOVJudicial system V1820GOV(Political changes, uprising, cargo cultsV1821GOV;large scale projects, dams,cities, land distribution, taxes V1822FAM5Changes in family structure, kinship terms, sex roles V1823FAMMarriage rituals,weddings V1824FAMspouse,mixed-marriages V1825FAMfemale role and status V1826TOL body toiletsV1827TOL dress customs V1828BEHdrugs: tabacoo, alcohol V1829BEHcooking methods V1830EDU'telegraph, American films, songs, dance V1831EDUschools, teachers V1832EDU2contact languages, foreign words, pidgin languages V1833HEA$foreign medical practices, hospitalsV1834HEAforeign diseasesV1835HEAsanitation methods V1836RELchanges in native religion V1837REL introduction of foreign religionV1838REL!burial practices or other rituals V1839SUMSum of Agriculture Changes V1840SUMSum of Behavior Changes V1841SUMSum of Changes in Education V1842SUMSum of Family Changes V1843SUMSum of Government Changes V1795_A Sum of Health Changes V1844SUMSum of Changes in Religion V1845SUMSum of Changes in TechnologyV1846SUMSum of Changes in Body Toilet V1847SUMSum of Changes in Trade V1848SUM Sum of Changes in TransportationV1849SUM(Sum Total of all Modernization Variables  V1850 -Secondary bone/body treatment: Original scale   V1851 Disarticulation: Original Scale   V1852 Secondary bone/body: Scale 2  V1853 Disarticulation: Scale 2  V1854 Secondary bone/body: Scale 3  V1855 Disarticulation: Scale 3  V1856 &Secondary bone/body treatment: Scale 4   V1857 Disarticulation: Scale 4  V1858 Region   V1859 Language family   V1860 Language Subfamily I  V1861 Language Subfamily 2V1862 Highest Number Counted V1863 Confidence in Counting Rating SCCSNUM V1864 Concord: with 100 mile radius V1865 Concord: with 150 mile radius V1866 Concord: with 200 mile radius V1867 Concord: with 250 mile radius V1868 Concord: with 300 mile radius V1869 Concord: with 350 mile radius V1870 Concord: with 400 mile radius V1871 Concord: with 450 mile radius V1872 Concord: with 500 mile radius V1874 Atlas: with 100 mile radius V1875 Atlas: with 150 mile radius V1876 Atlas: with 200 mile radius V1877 Atlas: with 250 mile radius V1878 Atlas: with 300 mile radius V1880 Atlas: with 350 mile radius V1882 Atlas: with 400 mile radius V1884 Atlas: with 450 mile radius V1886 Atlas: with 500 mile radius V1888 %Number of habitats in 100 mile radius V1889 Ocean within 100 miles? V1890 Lake within 100 miles? V1891 %Number of habitats in 150 mile radius V1892 Ocean within 150 miles? V1893 Lake within 150 miles? V1894 %Number of habitats in 200 mile radius V1895 Ocean within 200 miles? V1896 Lake within 200 miles? V1897 %Number of habitats in 250 mile radius V1898 Ocean within 250 miles? V1899 Lake within 250 miles? V1900 Site type at 100 miles V1901 Site type at 150 miles V1902 Site type at 200 miles V1903 Site type at 250 miles V1905 Latitude nearest weather stationV1907 !Longitude nearest weather station V1908 Station within 1 degree?V1909 Station within 2 degrees? V1910 Station within 3 degrees? V1911 Earliest date sampled V1912 Number of years sampled V1913 Mean yearly annual rainfall V1914 0Coefficient of variation in mean annual rainfallV1915 -Lowest yearly rainfall in the n years sampled V1916 .Highest yearly rainfall in the n years sampled V1917 /Difference between maxrain and minrain rainfall V19_22 V24_25 V26_27 V53_54 COMPLEX V159_177FORTITUDAGGRESSICOMPETIVSELFRELYACHIEVEMINDUSTRYRESPONSIOBEDIENCSELFRESTSEXRESTRID66  V2001_18%Deep Islamization / Christianization V2002_18World Religions V713REV (Pre-Classical) ReligionISLAM CHRISTIABUDDHISTHINDU HINDUBUDSHAMAN2 GAMESOFCGAMESOFSV1891_A NOMEURASV1893_A NOMAFROENOMOLDWONOMNEWWO  EXTERNALv774|780|783|892|894|903|1764   V1898_A v774|780|783|892|894|903V1899_A &v774|780|783|892|894|903(BandedExtWar)   INTERRNAv891|1769|1776|1777 V1901_A !v891|1769|1776|1777(BandedIntWar) EXTWARFAINTWARFA  FRATINTG%v562|564|568-572FratIntGroups60Factor V1905_A $v562|564|568-572FratIntGroups60Bands  FEMALEPOv657-661(FemPower107Factor) V1907_A v657-661(FemPower107Bands)   MALEAGGR v664-669(MaleAggression50Factor)V1909_A v664-669(MaleAggression50Bands)   MODERNIZ149|151-153|155-158|Statehood V1911_A 149|151-153|155-158|Statehood   POLITICA9157 237 158 777 156 90 153 151 152 155 776 19 Political82 V1913_A B157 237 158 777 156 90 153 151 152 155 776 19 Political82 (Banded)   JURIS_LE83 157 237 835 1132   V1915_A 83 157 237 835 Juris_Levels181 SIBL_IN v1233 1236 REGR factor score  BR_SI__M>v1226 1229 REGR factor score Brother-Sister & Parents X Affine   WIMO_DAH,v1227 1228 REGR factor score XSex Par-in-Law  MBD_FZS *v1231 1232 REGR factor score Cross-Cousins   SEX_PERM"v165 166 167 282 REGR factor score   UNEQUALG"v625 626 630 661 REGR factor score   SCARIFICv1692-1695 REGR factor score   CLASSSTR"v270 777 784 1721REGR factor score   STATESYS&factor of factors Juris Modern Pol Int   SEXPERM H(-) patrilocal | factor of factors SexPermiss__FemPower__UneqGender(neg)PATRILOCRecode of v69 Patrilocal=3   V1927_A )Patrilocal v625 626 661 REGR factor score   FAMILYTR$FamilyTrust&Affection v54 59 335 492  HOTDRY v854-56 HotDry V247A PD-MBdescentR247AV53R247AV MD-PDdescent  MALEDOMIv210-212 v621 (v53 weak)  V1934_A v210-212 v621   MONOGAMYv605-607  V1936_A v605-607 v629 V713KOROQstart with 2002-1807 recoded as v713koro, then -->713 values added if not missing ?Herding plus agriculture @Egalitarian farming @Individualistic farming@Semi-marketized?80% reliable category @70% reliable category @60% reliable category @50% reliable category ?No Trade @No Food Imports@Salt & Minerals only @ < 10% of Food @< 50% of Food/less local source@< 50% of food/more local source@ > 50% of Food  ?Direct exchanges @Indirect exchanges @ Local markets @ Middlemen @3 or 4 of above ?None @Non-Food Crops @< 10% @< 50% < single source @< 50% > single source @Primarily agricultural  ?Non-Food @ Vegetables @ Tree or Vine @Roots @Cereals?None @Present, not food source @< 10% Food Supply @< 50% chiefly meat @< 50% chiefly dairy @< 50% chiefly honey @> 50% ? Small Species @Pigs @Ovides @Equines@Reindeer @Camels @Bovines?None @< 10% Food Supply @< 50% < single source @< 50% > single source @> 50% ? Shellfish @ True Fish @Large aquatic animals @2 or more of above ?None @Not food source@< 10% Food Supply @< 50% < single source @< 50% > single source @> 50% ?Birds or Waterfowl @ Small Mammals @ Large Game @Two or more of above ?O None @U Not food source @S < 10% Food Supply @I < 50% < single source@D < 50% > single source@> 50% ?a Wild Animals products @h Wild Herbs, Leaves, Blossoms@p Tree Pith, e.g. Sago@r Wild Roots or Tubers @#s Wild Fruit, seeds, nuts, berries @v 2 or more of above ?Human Carriers, tumpline @ Pack Animals @ Draft Animals @Animal Drawn Wheeled vehicles @Motorized vehicles ?Unimproved Trails @Improved Trails/porters/animal @Unpaved roads/wheeled vehicles @ Paved Roads ? Not feasible @None, but feasible @Floats or rafts@Human powered crafts @Sail powered crafts @Motorized craftNone ?Small <10 people/load @Medium >10 people/load @Large >40 people/load ?No media of exchange or money @Domestically usable articles @Tokens of conventional value @Foreign coinage/paper currency @!Indigenous coinage/paper currency ? Personal loans/friends/relatives @Internal money @External money @ Banks or comparable institutions ?Year-round food supply, none @Year-round food supply, simple @Year-round foos supply, complex@Daily Variation, none @Daily Variation, simple@Daily Variation, complex @"Seasonal variation/barely adequate @Seasonal variation/adequate "@Seasonal variation/adequate $@ Annual variation/barely adequate &@Annual variation/adequate (@Annual variation/adequate *@Imported food/barely adequate ,@Imported Food/adequate ?None @Individual households @Communal facilities @Political agent controlled @Economic agent controlled ?None or barely adequate@Simple or adequate @Complez or> adequate ?year-round food supply locally @daily variation in food supply @seasonal variation @Annual variation @Imported food supply   ?Mo & Fa/different room @Mo same room/Fa different room @Mo same room/Fa unspecified @Mo same room/Fa different bed @$Mo, Fa same room/ beds not specified @Mo same bed/Fa different room @Mo same bed/Fa not specified @Mo same bed/Fa same room "@Mo & Fa same bed w/infant !?None except emergency @ Loose confinement/tether/playpen @Limited Space/bed/hammock @Movement limited/swaddling @Often Bound/Cradle Board "?None except emergency @ Loose confinement/tether/playpen @limited space/bed/hammock @Movement limited/swaddling @Often Bound/cradle board #?%Limited to routine/precautionary care @ Occasionally @ Up to 1/2 @ >1/2 time @Almost constantly $?%Limited to routine/precautionary care @ Occasionally @ Up to 1/2 @ > 1/2 time @Almost constantly %?None, skin contact @None/clothing/blanket @Sling or pouch @Basket @Rigid Cradleboard &?Back @Side @Front @Other '?Away from carrier @Toward Carrier (?Indifferent/punitive @Slow/perfunctory nurturant @Speedy but inconsistent@Generally speedy @ Always speedy )?Very Infrequent/brief @Infrequent/short @Infrequent/prolonged @frequent/short @frequent/prolonged *?Absent @Only neonatally/very mild pain @Occasional mild pain @$Frequent mild pain/infrequent severe @ Frequent pain @ very painful +?%Intercourse expected soon after birth @None @ 1 month or< @ 6 months or < @ 1 year or < @ 2 years or < @ > 2 years ,?None @Only in first 2 months @One occasion at later age @Two or more ceremonies @ Prominent -?None @"Only neonatal period, e.g. couvade @Slight, neonatally and later @Moderate, neonatally and later @!Exaggerated, neonatally and later .?No Special effort @Slight @Moderate, e.g. regular bath @%Some exceptional techniques/medicines @!Variety of exceptional techniques /?Before 1 Month @ 1-6 months @7-12 months, including solids @'7-12 months, only liquids/premasticated@After 12 months0?>2 years and gentle @>2 years and severe @>1 year and gentle @>1 year and severe @>6 months and gentle @>6 months and severe @< 6 months and gentle @< 6months and severe 1?&Discourage or punish early development @Ignore Development @%No active assistance, attention given @!Definite but inconsistent rewards @#Strong encouragement and assistance 2?>4 years and gradual @>4 years and abrupt @2-4 years and gradual @'2-4 years and gradual/< 2 yrs & gradual@< 2 years and abrupt 3None ?3-5 yeas @ >18 Months @>1 year@ >6 months @ <6 months 4Even adults uncovered ? Very Late @Late @>1 year@ < 6 months @ After Birth 5 ?up to 12 Months@ 13-20 Months @21-24 @25-30 @31-36 @37-42 @43-48 @49-60 "@ 61-72 months 6 ?up to 12 Months@ 13-20 months @21-24 @25-30 @31-36 @37-42 @43-48 @49-60 "@ 61-72 months 7?$1st in onset (among variables 46-50) @2nd @3rd @4th @5th 8?1st @2nd @3rd @4th @5th 9:;<?Almost exclusively mother @%Pricipally mother, others minor roles @)Principally mother, others impotant roles @Mother < 1/2 care @Mother minor but significant @Mother minimal except nursing =?Almost exclusively mother @)Principally mother, other important roles @Mother <1/2 care @Primarily others @exclusively others >?Distant@ Rarely close @Occasionally close @Frequently close @Regularly close?@?children, females @children, unspecified @children, both sexes @adult family, females @adult family, unspecified @adult family, both sexes @others, female "@others, both sexes A?peer group, single sex @peer group, unspecified@peer group, both sexes @older children, single sex @older children, unspecified @older children, both sexes @adults, single sex @adults, both sexes B?Severe or neglectful @Lesser severity@Occasional indulgence @Greater@Highly affectionate C?Low in category@Medium in category @High in catagory D?Severe @ Less Severity @Occasional severity @Greater leniency @Consistent leniency E?Low in category@Medium in catagory @High in Category F? Migratory @ Seminomadic-fixed then migratory @Rotating among 2+ fixed@(Semisedentary-fixed core, some migratory @Impermanent-periodically moved @ Permanent G? Dispersed @"Spatially separated subsettlements @%Partially dispersed with central core @CompactH?< 50 @50-99 @100-199@200-399@400-999@ 1,000-4,999 @ 5,000-49,999 @> 50,000 I?< 1 person / 5 sq. mile@1 person / 1-5 sq. mile@1-5 persons / sq. mile @1-25 persons / sq. mile@26-100 persons / sq. mile @101-500 persons / sq. mile @over 500 persons / sq. mile J?Conical@Beehive@Dome or hemispherical @Wedge-shape roof @Semicylindrical@ Cone-cylinder @-Rectangular on ground, vegetal material walls @Rectangular on piles "@$Rectangular on ground, mineral walls $@ Flat roofs &@Caves or rock shelters (@Tents *@Semisubterranean ,@ Miscellaneous K?None @%Residences of influential individuals @Secular or public building(s) @#Religious or ceremonial building(s) @Military structure(s) @ Economic or industrial buildings L?Large communal structures @Multi-family dwellings @Single family dwellings@Family homestead @'Multi-dwelling households, married pair@*Multi-dwelling households, husband rotates @,Multi-dwelling households, husbands separate @0Multi-dwelling households, individuals (married) M ?Monogamous, no polygyny@Monogamous, <20% polygyny @Polygynous, > 20% @ Polyandruos @S Stem family, monogamy@Stem family, < 20 % polygyny @Small extended, monogamy @Small extended, <20 % polygamy "@ >20% polygyny $@Large extended, monogamy &@Large extended, <20% polygyny (@Large extended, >20% polygyny N?(Matrilocal or uxorilocal-with wife's kin @.Avunculocal-w/husband's mother's brother's kin @Patrilocal or virilocal@+Ambilocal-w/ either wife's or husband's kin @Neolocal-separate from kin O?Matrilineal-through female line@,Double descent-through male and female lines @Patrilineal-through male line @1Ambilineal- through one parent in each generation @$Bilateral- not a corporate kin group PNone-Bilateral ?"Localized lineages->1per community @(Clan communities -core group and spouses @(Dispersed sibs- in different communities Q?Local endogamy 90-100% @Local endogamy 61-89% (agamous)@Local endogamy 40-60% (agamous)@ Local endogamy 11-39 % (agamous) @Local endogamy 0-10% (exogamy) R? Lacking/low compared to segments @By common residence only @$Common Identity, dialect, subculture @Overlapping kin ties @ Common social or economic status @Common political ties @Common religious ties S?Rites of Passage @ Calendrical @Magical or religious @,Individual sponsored and communally attended T?Feasting and/or drinking @Exchange other than food @ Entertainment @Sacrafice other than human @Human sacrifice@Masochistic behavior U?No centralized local leadership@Higher level only @Single local leader @Dual/plural headmen @Single local leader and council@Local councils @$Single local leader and subordinates @Too complex to be codedV ?No headmen or council @By appointment @ Seniority @ Divination @Informal Consensus @Electoral Process @ Patrilineal @ Matrilineal "@%Hereditary w/ personal qualifications W?No headman or council @By appointment @ Seniority @ Divination @Informal consensus @Electoral process @ Patrilineal X?Polyandry-primarily monogamous @Monogamy @Polygyny < 20% plural wives @Polygyny >20% plural wives Y?Nuclear Monogamous @Nuclear Poygynous @ Stem Family @Small extended @Large extended Z?Dependent totally @Semi-autonomous@ Tribute paid @De Facto Autonomy @#Equal status in pluralistic society @Fully autonomous [?Declining Autonomy @)Declining territory or population control @State of equilibrium @)State of equilibrium, expanding territory @Increasing autonomy \?Stateless society @%Sovereignty 1st hierarchical level up @%Sovereignty 2nd hierarchical level up @,Sovereignty 3rd or higher hierarchical level ]?Absent @ Peace group @ Alliances @ Confederation @International organization ^?Absent @Council@Executive and Council @Plural executive @ Single leader _ ?Absent @Patrilineal, Fa to So @#Patrilineal, Fa to faBr, then to So @Matrilineal, MoBr to SiSo @Matrilineal, MoBr to MoBr @ Ruling Family @Decision by limited power group @Elected by council "@Informal recognition $@Formal elections &@Appointee of alien society (@ Divination `?Absent @ Aristocrats @ Appointed @By ethnic components @Elective a?Absence of sovereignty @Absent @Relatives of executive @Favorites of executive @Secret society @Subordinate groups @ Hereditary @Subordinate functionaries b?Absent @ Not local @ Executive @Appointed by executive @ Priesthood @ Hereditary c?Not specialized@Incipient specialization @Retainers of chiefs @Military @ Specialized d?Absent @Popular Assemblies @Heads of kin groups @,Heads of decentralized territorial divisions @*Heads of centralized territorial divisions @Part of centralized system e?Absent @Patrlineal succession @Matrilineal succession @Ruling lineage @Seniority of age @Personal qualities @Formal election @Appointment by executive f Direct subsistence production ?Warfare wealth @Tribute or taxes @Slaves @Contributions of free citizens @Large land-holdings @Political Office @Foreign Commerce @Capitalistic enterprises "@Priestly services g ?Warfare wealth @Tribute or taxes @Slaves @Contributions of free citizens @Large land-holdings @Political Office @Foreign Commerce @Capitalistic enterprises "@Priestly services hijkl#Activity Present, Sex not Specified Task Absent ?Males Exclusively @Males Predominantly @Equally@Females Predominantly @Females Exclusively 1mnopqrstuvwxyz{|}~ Task Absent ?Males Exclusively @Males Predominantly @Equally@Females Predominantly @Females Exclusively ?None @Mnemonic devices @Nonwritten records @True writing; no records @True writing, records ?Nomadic@ Seminomadic @Sedentary; impermanent @ Sedentary ?None @10% food supply@10 %; secondary@Primary; not intensive @Primary; intensive ?fewer than 100 persons @100-199 persons@200-399 persons@400-999 persons@ 1000 persons ?None @ Pottery only @Loom weaving only @Metalwork only @Smiths, weavers, potters ? Human only @ Pack Animals @ Draft Animals @Animal-drawn vehicles @Automotive vehicles ?None @Domestically usable particles @Alien currency @Elementary forms @ True money ?< 1 person / sq. mile @1-5 persons / sq. mile @5.1-25 persons/ sq. mile @26-100 persons / sq. mile @100 persons / sq. mile ?None @Autonomous local communities @1 level above community@2 levels above community @3 levels above community ? Egalitarian @Hereditary slavery @#2 social classes, no castes/slavery @ 2 social classes, castes/slavery @/3 social classes or castes, w/ or w/out slavery?Adults & adults talk explicitly@Except w/ children @Except w/ certain people @Only with intimates @Never ? No abstinence @Abstinence at times @ Moderation @Abstinence admired ?Absent @With specific categories @Only unusual practices @Only sexual secretions @Always ?Present@Minimal@Absent ?Never @ Adulthood @Puberty@Toddler to puberty @Toddler@At birth ?Expected @ Tolerated @Mildly disapproved @Moderately disapproved @ Disallowed @Strongly disapproved ? Universal @Moderate @ Occasional @Uncommon ? Universal @Moderate @ Occasional @Uncommon ? Women always @Women more than men @ Both equally @Men more than women @ Men always ?Single standard- both allowed @Double standard- husband only @/Double standard- both forbidden, women punished@'Single standard- both condemn edequally?For any reason @Vis-a-vis specific group men @Vis-a-vis specific man @"Occasionally for sex gratification @For husband's economic benefit @Aside from sex gratification @None ?Accepted/ignored @ Ridiculed @Mildly disapproved @Strongly disapproved ?Absent @Rare @Common ?Men diffident, shy @&Men sexually forward but not diffident @Men forward verbally @Men forward physically @!Men forward; hostile occasionally @Men foward; hostile typically ?Accepted/ignored @None @Ridiculed, no punishment @Mildly disapproved @Strongly disapproved ?Absent @Present%@BCDEFJ? No concern @Concern Min (equator) T@ Max (pole) ?North @South .Min (Greenwich Meridian passes through London) f@Max (mid-Pacific Meridian) @East @West Min ܭ@Max  Min (1900) Q@ Max (1970)  Min (1900) @R@ Max (1973) 0Min =@Max @Min G@Max <Min F@Max Min Ӳ@Max NMin 8@Max Min D@Max Min @Max Min pr@Max  ?Jan @Feb @March @Apr @May @June @July @Aug "@Sept $@Oct &@Nov (@Dec  None ?1 @2 @3 @4 @5 @6 @7 @8 "@9 $@10 &@11 (@12  None ?1 @2 @3 @4 @5 @6 @6 @8 "@9 $@10 &@11 (@12 ?Africa @Circum-Mediterranean @ East Eurasia @Insular Pacific@ North America @ South America  0-5% Dependence?6-15% @16-25% @26-35% @36-45% @46-55% @56-65% @66-75% @76-85% "@86-100% Dependence ? Bride-Price @ Bride-Service @Token Bride-price @ Gift Exchange @#Sister or Female Relative Exchanged @Absence of Consideration @Dowry ? Bride-Price @ Bride-Service @Token Bride-price @ Gift Exchange @#Sister or Female Relative Exchanged @Absence of Consideration @Dowry "@No Alternative ?Nuclear Family, Monogamous @$Nuclear Family, Occasional Polygyny @Polyandrous Families @Polygynous: Unusual Co-wives @Polygynous: Usual Co-wife @Minimal extended families @Small extended families?Independ. Nuclear, Mongamous @!Independ. Nuclear, Occas Polygyny @)Prefer. Sororal, Cowives in Same Dwelling @+Prefer. Sororal, Cowives in Separ. Dwelling @'Non-Sororal, Cowives in Separ Dwellings@%Non-Sororal, Cowives in Same Dwelling @Independ Polyandrous Families @Extended Family?Monogamy @Occas or limited Polygyny @(Prefer sororal, cowives in same dwelling @)Prefer sororal, cowives in separ dwelling @&Non-sororal, cowives separate dwelling @.Non-sororal polygyny, cowives in same dwelling @ Polyandry, or no extended family ? Ambilocal @Nonestablishment of household @Uxorilocal: with Wife's Parents@!Virilocal: with Husband's Parents @Same as Prevalent Residence ?wife to husband's group@either group, Neolocal @husband to wife's group@no common residence @same as prevalent residence  $Nonestablishment of common household ?+Matrilocal: with wife's unileneal kin group @Uxorilocal: with wife's parents@Optional avuncu- or uxori-local@Bilocal: with either kin group @,Avunculocal: with husband's mother's brother @)Optional avuncu-, viri-, or patrilocality @!Virilocal: with husband's parents @/Patrilocal: with husband's unilineal kin groups"@Neolocal: independent of kin ?wife to husband's group@either group, Neolocal @husband to wife's group@No common residence  Nonestablishment of Household ?+Matrilocal: with wife's unilineal kin group @Uxrilocal: with wife's parents @Optional avuncu- or uxori-local@Bilocal: with either kin group @*Avunculocal: with husband's mother brother @*Optional avuncu-, viri-, or patri-locality @!Virilocal: with husband's parents @.Patrilocal: with husband's unilineal kin group "@Neolocal: independent of kin $@Same as prevalent residence ?Wife to Husband's Group@ Couple to either Group, Neolocal @Husband to Wife's Group@Same as Prevalent Residence ?Demes @+segmented communities without local Exogamy @Agamous communities @Exogamous communities @(Segmented communities with local Exogamy @Clan communities ?Demes @+Segmented communities without local Exogamy @Agamous communities @Exogamous communities @(Segmented communities with local Exogamy @Clan communities "@No secondary Organization ?none @"Patrilineal exogamy, no kin groups @Lineages in single community @Sibs @ Phratries @Moieties ?none @"Patrilineal exogamy, on kin groups @Lineages in single community @Sibs @ Phratries @Moieties "@ No difference ?None @"Patrilineal exogamy, no kin groups @Lineages in single community @Sibs @ Phratries @Moieties ?none @"Patrilineal exogamy, no kin groups @Lineages in single community @Sibs @ Phratries @Moieties "@ no difference ?Bilateral descent @+Kindreds: ego-oriented bilateral kin groups @(Ambilineal descent: lacking true ramages @,Ramages: ancestor oriented ambilineal groups @Exogamous ramages @,Quasi-lineages: filiation based, not descent "@Unilineal descent groups ?Bilateral descent @+Kindreds: ego-oriented bilateral kin groups @(Ambilineal descent: lacking true ramages @,Ramages: ancestor oriented ambilineal groups @Exogamous ramages @,Quasi-lineages: filiation based, not descent "@No secondary cognatic group ?All four cousins @Three of four cousins @Two of four cousins @One of four cousins @No first cousins @&First and some second cousins excluded @No first, unknown for second @No first or second cousins  ?All four cousins @Three of four cousins @Two of four cousins @One of four cousins @No first cousins @&First and some second cousins excluded @No first, unknown for second @No first or second cousins "@&No preferential or prescriptive unions ?FaSiDa @Paternal @ Uncle's Da @Other @ Aunt's Da @Maternal @MoBrDa ?FaSiDa @Paternal @ Uncle's Da @Other @ Aunt's Da @Maternal @MoBrDa "@&No preferential of prescriptive unions ?Descriptive terms @-Sudanese: siblings cross and parallel cousins @1Iroquois: cross cousins vs. parallel are siblings @Mixed or deviant @2Omaha: generational merging; MoBrCh up; FaSCh down @1Crow: generational merging; MoBrCh down: FaSch up @Eskimo: cousins vs. siblings @'Hawaiian: Siblings plus cousins equated?No agriculture @3Casual agriculture, incidental to other subsistence @!Extensive or shifting agriculture @ Horticulture @Intensive agriculture @Intensive irrigated agriculture?None or none specified @Non-food crops only @ Vegetables @ Tree fruits @Roots or tubers@ Cereal grains ?Nomadic or fully migratory @ Seminomadic @ Semisedentary @#Compact but impermanent settlements @,Neighborhoods of dispersed family homesteads @-Seperated hamlets, forming a single community @,Compact and relatively permanent settlements @Complex settlements ? Fewer than 50 @50-99 @100-199@200-399@400-1000 @(1,000 without any town of more than 5000 @!One or more towns of 5,000-50,000 @&One or more cities of more than 50,000 @ Two levels @ Three levels @ Four levels ? No levels @ One level @ Two levels @ Three levels @ Four levels ?Absent or not reported @(Present but not active in human affairs @#Present and active in human affairs @,Present, active, and specifically supportive ?None of the three types@Physical skill only @ Chance only @ Strategy only @Skill and chance @Skill and strategy @Chance and strategy @All ?None @No longer than 1 month @ 1 t 6 months @6 months to 1 year @More than 1 year to 2 years @More than 2 years  Absent ?#within first two months after birth @2 months to 2 years @ 2 to 5 years @ 6 to 10 years @11 to 15 years @16 to 25 years @25 to 50 years @After 50 years "@Normal age unclear ?Absence@Partial@/Complete, with relatives outside nuclear family@Complete, with non-relatives @Complete, with peers ?Absent @Not aboriginal @Prior to contract ?1Absence or near absence of large domestic animals @$Pigs th eonly large domestic animals @2Sheep and/or goats without larger domestic animals @Equine animals @Deer @Camels, alpacas, or llamas @Bovine animals ?1Little or no milking, or insufficient information @#Milked more often than sporadically ?Gathering contributes most @Fishing contributes most @Hunting contributes most @Pastoral contributes most @#Casual agriculture contributes most @&Extensive agriculture contributes most @&Intensive agriculture contributes most @&Two or more sources contribute equally ? Patrilineal @ Duolateral @ Matrilineal @Quasi-lineages @ Ambilineal @ Bilateral @Mixed  ?Males alone or almost alone @males appreciably more @'Differentiation but equal participation@*Equal partic. w/out marked differentiation @Females appreciably more @Females alone or almost alone @&Gender irrelevant, esp. industrialized @(Activity present: sex partic unspecified "@Activity absent or unimportant    ?*Junior age specialization (before puberty) @(Senior age specialization (beyond prime) @Craft specialization @Industrialized specialization "@5Task absent or age/occupational specialization absent    ?*Junior age specialization (before puberty) @)Senior age specialization (beyond prime) @Craft specialization @Industrialized specialization "@5Task absent or age/occupational specialization absent  missing data ?absence among free men @wealth distinctions @elite @dual @complex missing data ?absence among freemen @wealth distinctions @elite @dual @complex"@+no second type or absence of stratification ?absent or insignificant@despised occupational group(s) @ethnic stratification @complex?absent or insignificant@despised occupational group(s) @ethnic stratification @complex"@+no second type of absence of stratification ?absence or near absence@incipient or nonhereditary @ reported but type not identified @#hereditary and socially significant ?-absent or no difference from preceding column @formerly present  ?patrilineal heir @matrilineal heir @ nonhereditary @*nonhereditary on basis of seniority or age @nonhereditary through influence@8nonhereditary through election or other formal consensus @(nonhereditary through informal consensus "@absence of any such office !?hereditary by a son @$hereditary by other patrilineal heir @hereditary by a sister's son @$hereditary by other matrilineal heir "@+nonhereditary or absence of any such office "?.absence of individual property rights or rules @ matrilineal @other matrilineal heirs@'children, with daughters receiving less@ children, equally for both sexes @other patrilineal heirs@ patrilineal #?.absence of individual property rights or rules @ matrilineal @other matrilineal heirs@'children, with daughters receiving less@ children, equally for both sexes @other patrilineal heirs@ partilineal $?equal or relatively equal @'exclusively or predominantly to the one@ultimogeniture @ primogeniture %&?early marriage of females @insistence on virginity@1prohibited but weakly censured and not infrequent @+allowed, censured only if pregnancy results @0trial marriage, promiscuous relations prohibited @+freely permitted, even if pregnancy results '? semicircular @circular @'elliptical or elongated with round ends@ polygonal @rectangular or square @3quadrangular around (if only partially) inner court (?!subterranean or semi-subterranean @floor formed by ground @'elevated slightly or on raised platform@.raised substantially on piles, posts, or piers ). ?(stone, stucco, concrete, or fired blocks @)palster, mud and dung, or wattle and daub @8wood, including logs, planks, poles, bamboo, or shingles @bark @hides or skins @felt, cloth, or other fabrics @mats, latticework, or wattle @grass, leaves, or other thatch "@adobe, clay, or dried brick * ?rounded or semi-cylindrical @dome or hemisphere @beehive with pointed peak @conical@semi-hemisphere@shed (one slope) @flat or horizontal @gabled (two slopes) "@ hipped or pyramidal (fourslopes) + ?'stone or slate, or tile or fired blocks@,palster, clay, mud and dung, wattle and daub @8wood, including logs, planks, poles, bamboo, or shingles @bark @ hides or skin @felt, cloth, or other fabric @mats @%grass. leaves, brush, or other thatch "@ earth or turf $@ ice or snow ,? semicircular @circular @)elliptical or elongated with rounded ends @ polygonal @retangular or square @3quadrangular around (if only partially) inner court - ?(stone, stucco, concrete, or fired bricks @)plaster, mud and dung, or wattle and daub @8wood, including logs, planks, poles, bamboo, or shingles @bark @hides and skin @felt, cloth, or other fabrics @mats, latticework or wattle @grass, leaves, or other thatch "@adobe, clay, or dried brick / ?rounde or semi-cylindrical @dome or hemisphere @beehive with pointed peak @conical@semi-hemisphere@shed @flat @gabled "@hipped or pyramidal 0 ?&stone or slate, or tile or fired brick @/plaster, clay, mud and dung, or wattle and daub@8wood, including logs, planks, poles, bamboo, or shingles @bark @ hides or skin @felt, cloth, or other fabrics @mats @%grass, leaves, brush, or other thatch "@ earth or turf $@ ice or snow 1?Short: 7 yrs old @Medium: 9 yrs old @Long: 11 or more yrs 2!No Inculcation, or Opposite Trait @Moderately Strong Inculcation $@Extremely Strong Inculcation +3456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]?Parents predominantly @Siblings; not other children @.Primarily siblings, secondarily other children @.Primarily other children, secondarily siblings @Other children; not siblings ^_`a?Male Exclusively @Male Predominantly @ Both Sexes = @Female Predominantly @Female Exclusively ,bcdenopqrstu~?Exclusively parental @4Single atypical or occasional category of non-parent @-Two or more atypical or occasional categories @ missing data ?(Superincision, or subincision, or absent @ Circumcision ??Minor Observance or Informal @2Seclusion, or postpartum work taboo, or food taboo A missing data ?-both brideprice and patrilineality are absent @#either brideprice or patrilineality @:political subunit is greater than 1000, brideprice present @,size of political subunit is between 100-999 @6political subunit greater than 1000, brideprice absent G missing data ?low @unstable @high H missing data ?3not favoring formation of fraternal interest groups @/favoring formation of fraternal interest groupsI missing data ?not important @very important K4One, two or three of the variables have a score of 9 ?%All three variables have a score of 0 @0Only one of the three variables has a score of 1 @,two of the three variables have a score of 1 @%All three variables have a score of 1 L?All male @Males More Powerful @ More Equal @ Both Equal M? All males @Both sexes men more important @Both sexes fairly equal@ Both sexes female more important N? All males @Male more, more powerful @male more, while power equal @Female more powerful O? All males @Male predominance in power @Both, equal in power @Female predominance in power P? Only males @Both, male more common @Both, farily equal @Both, Female more prominent Q?Only for males @For both, and roughly equal R? Only males @Both sexes, male more powerful @#Both sexes, female equally powerful S?Include men only @Both, men more Infuence@Both, roughly equal influence T?Only men @Both, men do most fighting U?Low @- @- @- @- @- @- @High V?Men expend more@"Men and Women expend roughly equal @Women expend more W?None @For one activity @For one or more activity X?None @For one or more activity Y?Men and Women Segregated @Some Segregation @Little or no Segregation Z?Only Men @Both, Male of Preference @ Roughly equal @Female Preference [? Soley by Men @Most owned by men @Equal ownership@Most or all by Female \? Men Total say @Men have Predominant Say @Men and Women equal say@Women have total say ]? Men Total Say @Men Predominate Say @Men and Women Equal Say@Women Total Say^? Men Total Say @Men and Women Have equal Say @Women Predominate Say @Women Total Say_?Males do virtually None@ Males do some `?Yes @No, Equal Restriction a?Yes @No, Equal Restrictions @Male Punished Severely b?Not allowed and apparently rare@Not allowed and not uncommon @Allowed or very common c?No menstrual Taboos @,Rule VS. intercourse with Menstruating Women @"Personal restriction on Menstruals @(Belief that menstrual blood is dangerous @Menstruating women may not cook@&Menstrualing women segregated from men @5Menstrualing women, not have contact with male things d?Men important role @Belief Roughly Equal @Women Important role e?Men stronger urges @Belief urges are Equal @Women Stronger Urges f?Yes @No g?Male Monopolize arrangement @Both participate, men more say @Both participate, equal say @!Both partcipate, females more say h?Only the Groom refuse a match @%Groom more ability initiate or refuse @)Equal ability to initiate, refuse a match @(Bride, more ability to initiate or match i?woman exchange @Substantial Bride Price@ Bride service @Token Bride price @ Gift exchange @Dowry j?Polygnous unions over 20% @Polygnous unions under 20% @Monogamy @ Polyandry k?Only for males @Both, but commonly for males @ For neither @Both, but commonly for females l?Present@Absent m?Female moves farther away @About equal distance @Males moves farther away n?Only available to male @'Possible to both, difficult for females@Divorce equally possible @%Possible to both, difficult for males o?+Possible for both, fewer obstacles for male @Equally possible for both p?Women generally older @Ages about equal @Men 1-2 years older @Men 3-4 years older @Men more than 4 years older q?Monopolized by males @Is divided roughly equal @Is divided, females more say @Monopolized by females r?Virtually monopolized by males @Divided, but more male @Divided roughly equally@Divided, but females more s?None @"Husband Dominate Domestic decision @"Wife excluded from many gatherings @Wife rarely disputes husband @Husband has seating Priority @*Wife kneels and bows when greeting Husband t? For male @Equal, no preference @ For females u?Mostly for females @For both, or for neither @Mostly for males v?"Boys are trained earlier generally @$Training begins at roughly equal age @#Girls are trained earlier generally w?Boys are punish more severely @Punishment about equal @ Girls are punished more severely x?#Only husband hitting wife generally @Physical punishment by neither @either may hit the other y?Yes @No, evidence of rough equality @No, evidence of wife dominance z?only, men more Prominetly @Both equally perhaps segregated{?No initiations for females @$Customary minimal social recognition @"Personal dramatization of initiate @Organized social response @Affective social response |?Belief it has declined @No such belief, or no change @A belief it has improved }?Marked emphasis@Moderate emphasis @Little or no emphasis ~?Yes @No such belief ?No such statement @Somewhat informal influence @Much more informal influence ? Women, low control over property @ @ @!Women, high control over property ?Low power, women in kinship @ @High power, women in kinship ?!Low value placed on women's lives @ @"High value placed on women's lives ?Low value of women's labor @ @ @ @High value of women's labor ?Low women's domestic authority @ Med-Low @ Med-High @High women's domestic authority?Low female solidarity @ @High female solidarity ?4Stricter controls over women's marital, sexual lives @ @1Equal control over women's marital, sexuals lives ?High ritualized fear of women @ @Low ritualized fear of women ?!Low joint participation men-women @ @"High joint participation men-women ?bisexual patytern @merging pattern@bifurcate bisexual pattern @matri-skewed pattern @ null pattern @bifurcate pattern @patri-skewed pattern @ rare patterns  ?merging pattern@bisexual pattern @self-reciprocal pattern@bifurcate bisexual pattern @ null pattern @speaker's sex pattern @bifurcate pattern @bifurcate speaker's sex pattern"@ rare patterns  ?!simple bifurcate merging gpattern @#simple bifurcate collateral pattern @#skewed bifurcate collateral pattern @lineal pattern @generation pattern @/age-differentiated bifurcate collateral pattern@relative age pattern @0speaker differentiated bifurcate merging pattern "@3speaker differentiated bifurcate collateral pattern $@ rare patterns  ?$simple bifurcate collateral patterns @bifurcate merging pattern @lineal pattern @generation pattern @#skewed bifurcate collateral pattern @relative age pattern @/age-differentiated bifurcate collateral pattern @3speaker differentiated bifurcate collateral pattern "@ rare pattern  ? simple bifurcate merging pattern @,sex-differentiated bifurcate merging pattern @#simple bifurcate collateral pattern @simple lineal pattern @generation pattern @!sex-differentiated lineal pattern @/sex-differentiated bifurcate collateral pattern @'age-skewed bifurcate collateral pattern"@/age-differentiated bifurcate collateral pattern$@+sister-skewed bifurcate collateral pattern &@+brother-skewed bifurcate collateral pattern (@:rare pattern ElSbCh and YoSbCh distinguished byrelativeage *@9rare pattern between5and 7,distinguishing BrSo, SiSo,SbDa ?Dravidian Pattern @European Pattern @Yoruban Pattern@Algonkian Pattern @Kordofanian Pattern @Southern Bantu Pattern @East Polynesian Pattern @Quechuan Pattern "@Carolinian Pattern $@Siouan Pattern &@Caddoan Pattern(@Malagasy Pattern *@Jivaran pattern,@Voltaic Pattern.@Yukian Pattern 0@ Rare Patterns ?Hawaiian Pattern @Iroquois Pattern @Eskimo Pattern @ Omaha Pattern @ Crow Pattern @Descriptive Pattern @K Sudanese Pattern ?merging pattern@simple bisexual pattern@speaker's sex bisexual pattern @opposite sex pattern @ null pattern @differentiated pattern @strongly differentiated pattern @relative sex pattern "@sex-of-link bisexual pattern $@-spouse's sibling vs. sibling's spouse pattern *@Skewed Bisexual Pattern,@Paired Bisexual Pattern.@Relative Age Pattern 4@7a rare pattern WiBr=SiHu (ms), SiHu (vs), HuBr, SpSi , 5@Same Sex Pattern 6@-Rare Pattern, dist s.in low by, sex, age etc. 9@Unclassifiable patterns?Absence of such a cause@%Minor or relatively unimportant cause @An important auxiliary cause @+Predominant cause recognized by the society  ?All items absent @Flexible marriage mores only @"Plus Female nondomestic production @Plus demand for female produce @Plus female economic control @#Plus female political participation @Plus female solidarity groups ?No items present @Ideology of male toughness only@Plus separate places for men @Plus interpersonal violence @'Plus rape institutionalized or reported@%Plus taking wives from hostile groups ? Sexes equal @ Mythical Male @ Sexes unequal ?no menstrual restrictions @one restriction present@two restrictions @three @four @five ?none @1sexual intercourse prohibited during menstruation @1sexual intercourse prohibited at other times also @!men avoid or fear female genitals ?Female @Sexless@Couples@Male @Animal @Supreme being or force ?From wothin ('feminine') @Form within and without@From without ('masuline') @Void ?!From the body: Union and/or birth @From the body: Self-propagation@From other than the body @Cannot be determined ?feminine symbolism @couple symbolism @masculine symbolism ?)aboriginal area or mograted centuries ago @+recent migration, within past 100-150 years ? food constant @occasional hunger or famine @periodic or chronic hunger @,starvation or evidence of protein deficiency ?#absent or occasional or periodical @frequent or endemic ?Past, supralocal, or absent @!Present and endemic local warfare ? No initiation @Minimal social recognition @&Personal dramatization of the initiate @Organized social response @8Affective social response: beating, hazing or operations ?$No instructionalized male solidarity @Some exclusive male activity @$Ritualization given to this activity @,Definite ranking of men within this activity @0War training or planning a part of this activity ?&Patrilineal, Dual, bilateral, or other @ Matrilineal ? All other @ Matrilocal ?Nuclear@Stem @Lineal @Extended ?&Absence of local political integration @Autonomous local community @ Minmal state @ Little state @%State political integration in a unit ?By person or group wronged @By government action ?3Full time bureaucrats unrelented to government head @3No full time bureaucrats, or only relatives of head ?No @Yes 4567? Fully migratory or nomadic bands @ Seminomadic @.Neighborhoods of dispersed family settlements @Seperated hamlets @$Compact or permanent village or town @7Complex settlements surrounded by homesteads or hamlets?1Lack of significant stratification among free men @!Differences in wealth and control @9Dual stratification into hereditary elitesd and commoners @8Complex stratifiation into three or more classes/ castes ?Lack of strat. among free men @Differences in wealth & control@.Dual strat. into hereditary elites & commoners @,Complex strat. into 3 or more classes/castes ?Absence of all traits in scale @Crimes punished by government @Full-time specialized priests @Formal education @Written language @Full-time bureaucrats ?No items present @One or two items present @Three of four items present ?7Classical religion (Xianity, Islam, Hinduism, Buddhism)@#Mixture of classical & preclassical @ Preclassical ? Female excess @ Roughly equal @ Male excess ?No systematic absences @5Systematic absences - within memory of present adults @$Systematic absences common presently ? Both male @ Male & Female @ Both female ?One @Two @Three @ Four or Five @ Six to Nine ?One @Two @Three @ Four to Seven ? Under 300 @ 300 - 499 @ 500 - 999 @ Over 1000 ? All Males @Mixed Males & Females @ All Females ? All Americans @Some Americans @None Americans ?No Anthropologists @Some Anthropologists @All Anthropologists ? All had some @Some had @ None had any ?All knew it well @Some knew it well @None knew it well ?One year or less @One to three years @More than three years ?Before 1800 A.D. @ 1801 - 1900 @ 1901 - 1950 @After 1950 A.D.?,Dominant, the principal subsistence activity @-Co-dominant with one or more other categories @/Important, but not a major subsistence activity@#Present, but relatively unimportant @"Insignificant, Sporadic, or Absent ?@% A@% D@% F@% I@% K@% N@% @P@% Q@% R@% T@% @U@% V@% ;<=>?@? G Gathering @ H Hunting @ F Fishing @I Incipient Agriculture@D Domestic Animals @E Extensive Agriculture@N Intensive Agriculture @T TradeA 0% ?10% @20% @30% @40% @50% @60% @70% @80% "@90% $@100% BCDEF@ Not Approved @Normally Approved @Strongly Approved HI@Strictly Prohibited @Disapproved & Punished @Condoned & Not PunishedJK?Low, Mostly the Same @Substantial but Inconsistent @High with Formal Transition L?Low, Mostly the Same @Substantial, but Inconsistent @High, with Formal Transition M?Advanced Agriculture @ Horticulture @SImple or Shifting Cultivation @Domestic Animals @Exchange @Fishing@ Gathering @HuntingP?Advanced Agriculture @ Horticulture @Simple or Shifting Cultivation @Domestic Animals @Exchange @Fishing@ Gathering @HuntingQ?Independent local communities @%Single level of political integration @*Two levels of supra-community intergration @3Three or more levels of supra-community integration R?(Matrilineal, w/non-avunculocal residence @4Matrilnineal, w/predominnatly avuncuolocal residence @?No change/Not applicable ?Change is settlement patterns 9No change/Not appplicable ?Change in expansion :No change/Not applicable ? Major loss ;No ?Yes <None ?Peaceful Colonization @.Warlike expansion without conq or colonization @Conquest but not colonization @Conquest and colonization BNone ?Once @ 2 or 3 times @Very freq or continual CNone ? Neighboring @ 10-200 miles @Over 200 miles @Different continent DNone ?%Peaceful colonization or displacement @CWarlike expansion and displacement without conquest or colonization @Conquest but not colonization @Conquest and colonization @Colonization but not conquest ENone ?Once @ 2 or 3 times @Very freq or continual F?None @Animal disease @ Crop disease @,Human (Disease, Starvation or State Warfare) @2 & 3 @2&4 @ All three GNone HNone ?Had not recovered X@%less than 10 years before observation INone JNone ?Had not recovered K?None @Voluntary migration @.Voluntary migration as a world market response @Forced migration M?None @Voluntary migration @.Voluntary migration as a world market response @Forced migration NNone ONone PNot applicable @Expansion due to pop. pressure @Expansion to depopulated areas @$Expansive, in conflict, trade access @"Defensive, in peaceful competition @0Defensive, in violent conflict with other groups @BGovt resettlement for labor, pacification, colonizing, agriculture @Other Q Not applicable ?Positive, e.g., trade expanded @Little or no effect @,Transformed agriculture to private ownership @3Increased stratification, war (e.g., due to horses) @&Grouped into villages to resist attack @Weakened @&Disrupted lrad'l groups, or fragmented @'Disrupted lifestyle or subsistence baseRNo ?Granted original lands @&Original lands, must carry pass or ID @Original lands, mustremain @Resettlement on marginal land @!Resettlement & no right elsewhere S?No @ Yes, minor @ Yes, moderate @ Yes, major @Code unresolvedTNo warfare to restrict ?"Warfare present and not restricted @#Warfare discouraged but not stopped @.Warfare restricted and reduced but not stopped @Warfare restricted and stopped V No warfare to restrict ?Warfare not restricted @Little or no effect @"Women not enslaved, men not killed @+Men's trade up, womens contribution reduced @More feasting among men@>Men's labor free for cash cropping, wage labor, or agriculture @1New means of dispute settlement, rely on new govt @Breakup of age grading "@9Breakup of stratification, slavery, or political stratif. W None ? Migratioon @Disease or depopulation@Conquest @)Conquest and colonization (count as two!) @)Resettlement on reservation or land grant @ Two of above @Three of above @ Four of above "@ Five of above X low or absent ?high YAbsent ?Present@7Civil War, in absence of fueding or other internal warsZ?Yes [ No ?Yes \absent ?present]?? ??? @?? ^?10-99 @100-999@ 1000-9999 @ 10000-99999 @ 100000-999999 @1000000-9999999@10000000-99999999 @100000000-999999999 _8Agriculuture not practiced or confined to non-food crops $@ Buckwheat &@Wheat (@Barley *@Millet ,@Sorghum.@Maize 0@Dry Rice 1@Wet Rice 2@Rye 3@Teff 5@Yam 6@ Taro or Okuma 7@ White Potato 8@Cassava (Manioc) 9@ Sweet Potato :@Tubers in general ?@Bananas or Plantains @@ Breadfruit @@CoconutA@Ensete A@Sago and other Palms B@Pandanus ` 9Agricultureal not practiced or confines to non-food crops ? No secondary agricultural staple $@ Buckwheat &@Wheat (@Barley *@Millet ,@Sorghum.@Maize 0@Dry Rice 1@Wet Rice 2@Rye 3@Teff b Good Data ? Inferential c7Agriculture not practiced or confined to non-food crops?;Plow-negative(Millet,Sorghum,Maize,Dry Rice,Rye,Root Crops) @ 1,500) @)Peace groups transcending local community @Minimal States (15,00-10,000) @Little States (10,000-100,000) @States (at least 100,000) @Dependent societies i? 3 conjugal relationships or less @4-10 conjugal relationships @11-100 conjugal relationships @$More than 100 conjugal relationships j?6Despotism absent: bias in the resolution of individual @9Depotism present: Conflicts of interest among individuals k?7Perquisistes are small, reward less than a bride price @? None/No weeding/crops not weeded ?Crop weeded once @Crop weeded twice @Crop weeded three times@0Weeding, but not extensively, no data on # times @%Extensive weeding, no data on # times @%Weeding, no data on extent or # times 9No agriculture ?Crops supervised form homestead@3Distant crops supervised, e.g. huts built in fields :No agriculture ?Seeds broadcast@Seeds planted by hand/manually @Seedlings transplanted @Cuttings planted @ 1 and 2 above @ 2 and 3 above ; No agriculture ?0 years (permanent cultivation)@2 years@3 years@4 years@5 years@6 years@7 years$@10 years .@15 years 4@20 years < Activity not present ?Men only @Men Predominant@Men and Women Equal @Women Predominant @ Women Only @Not an Adult Task @Adult Task, No Data on Sex @Men, No Data on Women "@Women, No Data on Men $@ Slaves Only @ABCDEFGHIJKLM Children this age do not to task ? Boys this age @Girls this age @Boys and Girls this age @Not a Child's Tasl @Child Task, no Data on Sex N Children this age do not do task ?Boys this age @Girls this age @Boys and Girls this age@Not a Child's Task @Child Task, no Data on Sex OX Children this age do not do task ? Boys this age @Girls this age @Boys and Girls this age@Not a Child's Task @Child Task, no Data on Sex PQRTUW[\]^_`ab Children this age so not do task ? Boys this age @GIrls this age @Boys and Girls this age@Not a Child's Task @Child Task, no Data on Sex S Children this age do not do task ? Boys this age @Girls this age @Boys and Girls this age @Not a Child's Task @Child Task, no Data on Sex V Children this age do not do task ? Boys this age @Girls this age @Boys and Girls this age@Not a Child's Tasl @Child Task, no Data on Sex Y Children this age do not do task ? Boys this age @Girls this age @Boys and Girls this age@Not a Child's Task @Child Task, no Data on Sex Z!None (e.g., Activity not present) ?Product consumer is child only @*Product consumer is household or community @Wage labot/product sold@(Household and wage labor or product sold @ 1 &2 above @ All of above cActivity not present ?Yes, Children do this @No, children do not do this defghijklmnopqrstuvwxBoys do not do this task ? The most important task for boys @8Boys commonly do the task, but not their most important @(Boys rarely do, or usually done by girls |Boys do not do this task ? The most important task for boys @6Boys commonly dothe task, but not their most important @(Boys rarely do, or usually done by girls }Girls do not do this task ?!The most important task for girls @9Girls commonly do the task, but not their most impportant @)Girls rarely do, or usually done by girls Girls do not do this task ?!The most important task for girls @9Girls commonly do the task, but not their most important @)Girls rarely do, or usually done by girls Girls do not di this task ?!The most important task for girls @8Girls commonly do the task, but not their most important @)Girls rarely do, or usually done by girls Girls do not do this task ?!The most important task for girls @7Girls commonly do the tsk, but not their most important@)Girls rarely do, or usually done by girls Girls do not do this task ? The most important tsk for girls @8Girls commonly do the task, but not their most important @)Girls rarely do, or usually done by girls Girls do not so this task ?!The most important task for girls @8Girls commonly do the task, but not their most important @)Girls rarely do, or usually done by girls  None(e.g., Activity not present) ?Common or important adult task @0Not preferred by adults, considered child's task @7Usually adult task;kids do only if suitableafult absent No agriculture ?barley @Maize @Millet @Dry rice @Wet rice @Sorghum@Wheat @ Buckwheat &@ Groundnut (@Beans *@ Breadfruit ,@Cassava.@Potato 0@ Sweet potato 1@Squashes 2@Taro 3@Yams 4@Bananas5@ Plantains 6@Dates 7@Mango 8@Other fruit trees ?@Coconut@@Peanut D@Cocoa E@Cotton E@Sesame F@ Sugarcane F@Cardamum G@Rubber I@ Animal fodder  None/No weeding/crops not weeded ?Crop weeded once @Crop weeded twice @Crop weede three times @0Weeding, but not extensively, no data on # times @%Extensive weeding, no data in # times @%Weeding, no data on extent or # times No agriculture ?Crops supervised from homestead@2Distant crops supervised, e.g.huts built in fields No agriculture ?Seeds broadcast@Seeds planted by hand/manually @Seedlings tranplanted @Cuttings planted @ 2 and 3 above @ 3 and 4 above @ 2 and 4 above  No agriculture ?0 years (permanent cultivation)@2 years@3 years@4 yeas @5 years@6 years@7 years$@10 years .@15 years 4@20 years  Activity not present ?Men only @Men Preodominant @Men and Women Equal @Women Predominant @ Women Only @Not an Adult Task @Adult Task, No Data on Sex @Men, No Data on Women "@Women, No Data on Men $@ Slaves Only  Activity not present ?Men Only @Men Prodominant@Men and Women Equal @Women Predominant @ Women Only @Not an Adult Task @Adult Task, No Data on Sex @Women, No Data on Men "@Women, No Data on Men $@ Slaves Only  Activity not present ? Boys only @Boys Predominant @Boys and Girls Equal @Girls Predominant @ Girls only @Not a Child's Task @Child Task, No Data on Sex @Boys, No data on Girls "@Girls, No data on Boys $@ Slaves only  Activity not present ? Boys only @Boys Predominant @Boys and Girls Equal @Girls Predominant @ Girls only @Not a Childs's Task @Child Task, no data on Sex @Boys, No Data on Girls "@Girls, No Data on Boys $@ Slaves Only  Children this age do not do task ? Boys this age @Girls this age @Boys and Girls this age@Not a Child's Task @Child Task, no Data on Girls @Boys this age, No data on Girls@Girls this age, No data on Boys Children this age do not to task ? Boys this age @Girls this age @Boys and Girls this age@Not a Child's Task @Child Task, no Data on Sex @Boys this age, No data on Sex @Girls the age, No data on Boys  Children this age do not do task ? Boys this age @Girls this age @Boys and Girls this age@Not a child's task @Child Task, no data on Sex @Boys this ae, No data on Girls @Girls this age, no data on Boys Children thsi age do not do task ?Boys this age @Girls this age @Boys and Girls this age @Not a Child's Task @Child task, no data on sex @Boys this age, no data in girls@Girls this age, no data on Boys Children this age do not do task ?Boys this age @Girls this age @Boys and Girls this age@Not a Child's Task @Child Task, no data on Girls @Boys this age, No data in Girls@Girls this age, No data on Boys Children this age do not do task ? Boys this age @Girls this age @Boys and Girls this age@Not a Child's task @Child task, no data on Sex @Boys this age, No data on Girls@Girls this age, no data on Boys!None (e.g., activity not present) ?Product consumer is child only @*Product consumer is household or community @Wage labor/product sold@(Household and wage labor or product sold @1 and 2 above @ All of above !None (e.g., activity not present) ?Yes, children do this @No, children do not do this !None (e.g., activity not present) ?Yes, children do this @No, chilfren do not do this !None (e.g., activity not present) ?Yes, children do this @No, children do not do this Boys do not do this task ? The most important task for boys @7Boys commonly do the task, but not their most important@)Boys rarely do, or ususally done by girls Boys do not do this task ?The most important tsk for boys@6Boys commonly do the tsk, but not their most important @(Boys rarely do, or usually done by girls Girls do not do this task ? The most imortant task for girls @8Girls commonly do the task, but not theri most important @*Girls rearly do , or usually done by girls !None (e.g., Activity not present) ?Common or importatn adult task @0Not preferred by adults, considered child's task @9Usually adult task; kids do only if suitable adult absent !None (e.g., Activity not present) ?Common or important adult task @0Not preferred by adults, considered child's task @9Usually adult task; kids do only uf suitable adult absent Absent ?Present, minor @Present, important  Activity not present ?Men Only @Men Predominant@Men abd Women Equal @Women Predominant @ Women Only @Not an Adult Task @Adult Task, No Data on Sex @Men, No Data on Women "@Women, No Data on Men $@ Slaves Only  Children this age do not do task ?Boys this age @Girls this age @Boys and Girls this age@Not a Child's Task @Child Task, no Data on Sex @ Boys this age, No Data on Girls @ Girls this age, No Data on Boys !None (e.g., activity not present) ?Product consumer is child only @*Product consumer is household or community @Wage labor/product sold@)Household and wage labor or product sold @ 1 and 2 above @ All of above  None (e.g.,activity not present) ?Yes, children do this @No, children do not do this Boys do not do this task ?"The most important task for girls @9Girls commonly do the task, but not their most important @*Girls rarely do, or usually done by girls Girls do not do this task ?!The most important task for boys @9Girls commonly do the task, but not their most important @*Girls rarely do, or usually done by girls Boys so not do this task ?"the most important task for girls @8Boys commonly do the task, but not their most important @)Boys rarely do, or usually done by girls Girls do not do this task ?9Girls commonly do the task, but not their most important @9Girls commonly do the task, but not their most important @*Girls rarely do, or usually done by girls !None (e.g., Activity not present) ?Common or important adult task @1Not preferred by adults, considered child's task @:Usually adult task; kids do only if suitable adult absent #None (e.g., Activity not present ) ?Common or important adult task @1Not preferred by adults, considered child's task @:Usually adult task; kids do only id suitable adult absent Absent ?Present, minor @Present, important  Activity not present ?Men Only @Men Predominant@Men and Women Equal @Women Predominant @ Women Only @Not an Adult Task @Adult Task, No Data on Sex @Men, No Data on Women "@Women, No Data on Men  Activity not present ? Boys Only @Boys Predominant @Boys and Girls Equal @Girls Predominant @ Girls Only @Not a Child's Task @Child's Task, no Data on Sex @Boys, No Data on Girls "@Girls, No Data on Boys  Children this age do not do task ? Boys this age @Girls this age @Boys and Girls this age@Not a Child's Task @Child Task, no Data on Girls @Boys this age, No Data on Girls@Girls this age, No Data on Boys Children this age do not do task ? Boys this age @Girls this age @Boys and Girls this age@Not a Child's Task @Child Task, no Data on Sex @ Boys this age, No Data on Girls @Girls this age, No Data on Boys Children this age do not do task ? Boys this age @Girls this age @Boys and Girls this age@Not a Child's Task @Child Task, no Data on Sex @Boys this age, No Data on Girls@Girls this age, No Data on BoysNone ?Child @Parents@Other @Child and Parents Activity not present ?Yes, Children do this @No, Children do not do this Activity not present ?Yes, Children do this @No, Children do not do this (Boy do not do this task ? The most important task for boys @7Boys commonly do the task, but not theri most important@(Boys rarely do, or usually done by girls Girls do not do this task ?!The most important task for Girls @8Girls commonly do the task, but not theri most important @(Girls rarely do, or usually done by boys  None (e.g.,Activity not present) ?Common or important adult task @0Not preferred by adults,considered childs's task @9Usually adult task; kids do only if suitable adutl absent  Activity not present ?Men Only @Men Predominant@Men and Women Equal @Women Predonminant @ Women Only @Not an Adult Task @Adutl Task, No Data on Sex @Men, No Data on WOmen "@Women, No Data on Men  Activity not present ? Boys Only @Boys Predominant @Boys and Girls Equal @Girls Predominant @ Girls Only @Not a CHild's Task @Child Task, no Data on Sex @Boys, No Data on Girls "@Girls, No Data on Boys  Children this age do not do task ? Boys this age @Girls this age @Boys and GIrls this age@Not a Child's Task @Child Task, no Data on Girls @Boys this age, No Data on Girls@Girls this age, No Data on Boys Children this age do not do task ? Boys this age @Girls this age @Boys and Girls this age@Not a Child Task @Child Task. No Data on Sex @Boys this age, No Data on Girls@Girls this age, No Data on Boys Children this age do not do task ?Boys this age @Girls this age @Boys and Girls this age@Not a Child's Task @Child Task, No Data on Sex @Boys this age, No Data on Boys None ?Child @Parents@Other @Child and Parents Activity not present ?Yes, Children do this @No, Children do not do this Activity not present ?Yes, CHildren do this @No, Children do not do this Girls do not do this task ?!The most important task for Girls @8Girls commonly do the task, but not their most important @(Girls rarely do, or usually done by boys !None (e.g., Activity not present) ?Common or important adult task @0Not preferred by adults, considered child's task @9Usually adult task; kids do only if suitable adult absent  Activity not present ? Boys Only @Boys Predominant @Boys and Girls Equal @Girls Predominant @ Girls Only @Not a Child's Task @Child's Task, No Data on Sex @Boys, No Data on Girls "@Girls, No Data on Boys  Children this age do not do task ?Boys this age @Girls this age @Boys and GIirls this age @Not a Child's Task @Child Task, no Data on Girls @Boys this age, No Data on Girls@Girls this age, No Data on Boys Children this age do not do task ?Boys this age @Girls this age @Boys and Girls this age @Not a Child's Task @Child Task, no Data on Sex @Boys this age, No Data on Girls@Girls this age, No Data on Boys!None (e.g., activity not present) ?Product consumer is child only @*Product consumer is household or community @Wage labor/product sold@(Household and wage labor or product sold @ 1 and 2 above Activity not present ?Yes, Children do this @No, children do not do this Activity not present ?Yes, Children do thsi @No, Children do not do this Girls do not do this task ?!The most important task for boys @7Boys commonly do the task, but not their most important@(Girls rarely do, or usually done by boys Girls do not do this task ?!The most important task for Girls @9Girls commonly do the task, but not their most important @(Girls rarely do, or usually done by boys  Activity not present ? Men Only @Men Predominant @Men and Women Equal @Women Prredominant @ Women Only @Not an Adult Task @Adult Task, No Data on Sex @Men, No Data on Women "@Women, No Data on Men  Activity not present ? Boys Only @Boys Predominant @Boys and Girls Equal @Girls Predominant @ Girls Only @Not a Child's Task @Child Task, No Data on Sex @Boys, No Data on Girls "@Girls, No Data on Boys !Children this age do not do task ?Boys this age @Girls this age @Boys and Girls this age @Not a Child's Task @Child Task, no Data on Sex @ Boys this age, No Data on Girls @ Girls this age, No Data on Boys !Children this age do not do task ?Boys this age @Girls this age @Boys and Girls this age "Children this age do not do task ?Boys this age @Girls this age @Boys and Girls this age @Not a Child's Task @Child Task, No Data on Girls @ Boys this age, No Data on Girls @ Girls this age, No Data on Boys  None (e.g.,activity not present) ?Product sondumer is child only @+Product consumer is household or community @Wage labor/Product sold @)HOusehold and wage labor or product sold @1 and 2 above @All Activity not present ?Yes, Children do this @No, Children do not do this  &'123Boys do not do this tasl ?!The most important task for boys @8Boys commonly do the task, but not their most important @)Boys rarely do, or usually done by girls Girls do not do this task ?"The most important task for Girls @9Girls commonly do the task, but not their most important @*Girls rarely do, or ususally done by boys  !None (e.g.,Activity not present) ?Common or important adult task @1Not preferred by adults, considered child's task @9Usually adult task;kids do only if suitable adult absent   Activity not present ? Men Only @Men Predominant @Men and Women Equal @Women Predominant @ Women Only @Not an Adult Task @Adult Task, No Data on Sex @Men, No Dara on Women "@Women, No Data on Men   Activity not present ? Boys Only @Boys Predominant @Boys and Girls Equal @Girls Predominant @ Girls Only @Not a Child's Task @Child Task, No Data on Girls @Boys, No Data on Girls "@Girls, No Data on Boys  !Children this age do not do task ?Boys this age @Girls this age @Boys and Girls this age @Not a Child's Task @Child Task, No Data on Sex @ Boys this age, No Data on Girls @ Girls this age, No Data on Boys  !Children this age do not do task ?Boys this age @Girls this age @Boys and Girls this age @Not a Child's Task @Child Task, No Data on Girls @ Boys this age, No Data on Girls @ Girls this age, No Data on Boys Boys do not do this task ?!The most important task for boys @7Boys commonly do the task, but not their most important@)Boys rarely do, or usually done by girls Girls do not do this task ?"The most important task for girls @9Girls commonly do the task, but not their most important @*Girls rarely do, or usually done by girls !None (e.g., Activity not present) ?Common or important adult task @1Not preferred by adults, considered child's task @9Usually adult task; kids do only if suitable adult absent + Activity not present ? Men Only @Men Predominant @Men and Women Equal @Women Predominant @ Women Only @Not an Adult Task @Adult Task, No Data on Sex @Men, No Data on Sex "@Women, No Data on Men !Children this age do not do task ?Boys this age @Girls this age @Boys and Girls this age @Not a Child's Task @Child Task, No Data on Sex @Boys this age, No Data on Girls@ Girls this age, No Data on Boys !CHildren this age do not do task ?Boys this age @Girls this age @Boys and Girls this age @Not a Child's Task @Child Task, No Data on Sex @ Boys this age, No Data on Girls @ Girls this age, No Data on Boys !Children this age do not do task ?Boys this age @Girls this age @Boys and Girls this age @Not a Child's Task @Child Task, No Data on Sex @ Boys this age, No Data in Girls @ Girls this age, No Data on Boys Boys do not do this task ? The most important task for boys @7Boys commonly do the task, but not their most important@)Boys rarely do, or usually done by girls Girls do not do this task ?!The most important task for Girls @9Girls commonly do the task, but not their most important @)Girls rarely do, or usually done by girls  None (e.g, Activity not present) ?Common or important adult task @1Not preferred by adults, considered child's task @:Usually adult task; kids do only if suitable adutl absent   Activity not present ? Men Only @Men Predominant @Men and Women Equal @Women Predominant @ Women Only @Not adn Adult Task @Adult Task, No Data on Sex @Men, No Data on Women "@Women, No Data on Men ! Activity not present ? Boys Only @Boys Predominant @Boys and Girls Equal @Girls Predominant @ Girls Only @Not a Child's Task @Child Task, No Data on Sex @Boys, No Data on Girls "@Girls, No Data on Boys " !Children this age do not do task ?Boys this age @Girls this age @Boys and Girls this age @Girls Predominant @ Girls Only @Not a Child's Task @Child Task, No Data on Sex @Boys, No Data on Girls "@Girls, No Data on Boys # Children this age do not do task ?Boys this age @Girls this age @Boys and Girls this age@Not a Child's Task @Child Task, No Data on Sex @ Boys this age, No Data on GIrls @ Girls this age, No Data on Boys $ Children this age do not do task ?Boys this age @Girls this age @Boys and Girls this age @Not a Child's Task @Child Task, No Data on Sex @ Boys this age, No Data on Girls @ Girls this age, No Data on Boys %Boys do not do this task ? The most important task for boys @8Boys commonly do the task, but not their most important @)Boys rarely do, or usually done by girls )Girls do not do this task ?"The most important task for Girls @9Girls commonly do the task, but not their most important @)Girls rarely do, or usually done by boys * Activity nhot present ?Men Only @Men Predominant@Men and Women Equal @Women Predominant @ Women Only @Not an Adult Task @Adult Task, No Data on Sex @Men, No Data on Women "@Women, No Data on Men , Activity not present ? Boys Only @Boys Predominant @Boys and Girls Equal @Girls Predominant @ Girls Only @Not a Child's Task @Child Task, No Data on Sex @Boys, No Data on Girls "@Girls, No Data on Boys -!Children this age do not do task ?Boys this age @Girls this age @Boys and Girls this age @Not a Child's Task @Child Task, No Data on Sex @Boys this age, No Data on Girls@ Girls this age, No Data on Boys ."Children this age do not do task ?Boys this age @Girls this age @Boys and Girls this age @Not a Child's Task @Child Task, No Data on Sex @ Boys this age, No Data on Girls @ Girls this age, No Data on Boys / Children this age do not do task ?Boys this age @Girls this age @Boys and Girls this age @Not a Child's task @Child Task, No Data on Sex @Boys this age, No Data on Girls@ Girls this age, No Data on Boys 0Boys do not do this task ?!The most important task for boys @9Boys commonly do the task, but not their most importanta @*Boys rarely do, or usually done by girls 4GIrls do not do this task ?8The most important task, but not their most important @9Girls commonly do the task, but not their most important @*Girls rarely do, or ususally done by boys 5!None (e.g., Activity not present) ?Common or important adult task @1Not preferred by adults, considered child's task @:Usually adult task; kids do only if suitable adutl absent 6$No resolved rating (original code 0) ?4Warfare seems to be absent or rare (original code 1) @original code 1.25 @original code 1.5 @original code 1.625 @original code 1.75 @or = to3 @ $No resolved rating (original code 0) ?4The defeated are never driven form their territory @original code 1.5 @@ Eskimo-Aleut ?@Na-Dene@@Algic @@Salish A@Siouan A@Iroquian B@CaddoanB@Hokan C@California and Plateau PenutianC@Natchez-Muskogean D@ Uto-Axtecan D@ Macro-Mayan E@Chibcha-Misumalpan E@Macro-Arawakan F@ Macro-Paezan F@ Macro-Panoan G@ Tupi-Carib G@Tucanoan H@Jivaroan H@ Quechumaran I@ Nambiquaran I@Macro Ge J@Mascoian J@ Guaykuruan K@ Araucanian K@ Tehuelche X@Isolate:Isolate or no subfamily 1 ?Khoisan: Southern Khoisan @Khoisan: Hadza@Niger Congo: Central @Niger Congo: Mande @Niger Congo: West Atlantic @Niger Congo: Kordofanian @Nilo-Saharan: Songhai @Nilo-Saharan: East Sudanic "@Nilo-Saharan: Fur $@Nilo-Saharan: Saharan &@Nilo-Saharan: Komuz (@Afro-Asiatic: Berber *@fro-Asiatic: Chadic ,@Afro-Asiatic: Omotic .@Afro-Asiatic: Cushitic 0@Afro-Asiatic: Semitic 4@Indo-European: Armenian5@Indo-European: Indo-Iranian 6@Indo-European: Albanian7@Indo-European: Italic 8@Indo-European: Celtic 9@Indo-European: Balto-Slavic :@ Indo-European: African-IE Creole <@Dravidian: Central Dravidian =@Dravidian: South Dravidian >@Sino-Tibetan: Sinitic ?@Sino-Tibetan: Tibeto-Burman @@Austroasiatic: Munda @@Austroasiatic: Mon-Khmer A@Austronesian: Atalyic A@Austronesian: Malayo-PolynesianB@Trans New Guinea: Main B@Trans New Guinea: Trans-Fly C@Trans New Guinea: Timor-Alor D@ralic-Yukaghir: Yukaghir D@Uralic-Yukaghir: UralicE@Altaic: Turkic E@Altaic: Mongolian-Tungus F@Eskimo-Aleut: Aleut F@Eskimo-Aleut: Eskimo I@Na-Dene: Haida I@Na-Dene: Athabaskan-Eyak J@ Algic: Ritwan J@Algic: Algonquian K@Uto-Aztecan: Northern K@Uto-Aztecan: Southern L@Macro-Mayan: Mixe-Zoquean L@Macro-Mayan: Mayan M@Chibcha-Misumalpan: Misumalpan M@Chibcha-Misumalpan: Chibcha N@#Macro-Arawakan: Maipiran (Awawakan) N@Macro-Arawakan: Otomakoan O@Macro-Panoan: Panoan O@Tupi-Carib: Carib P@Tupi-Carib: Tupian @P@Macro Ge: Botocudan P@ Macro Ge: Ge Isolate or no subfamily 2 ?#Niger Congo: Central: North Central @#Niger Congo: Central: South Central @#Nilo-Saharan: East Sudanic: Nilotic @"Nilo-Saharan: East Sudanic: Nubian @Afro-Asiatic: Cushitic: Central@Afro-Asiatic: Cushitic: Eastern@Afro-Asiatic: Semitic: Central @Afro-Asiatic: Semitic: Southern"@"Indo-European: Indo-Iranian: Indic $@$Indo-European: Indo-Iranian: Iranian &@$Sino-Tibetan: Tibeto-Burman: Tibetic (@"Sino-Tibetan: Tibeto-Burman: Baric *@#Sino-Tibetan: Tibeto-Burman: Burmic ,@Austroasiatic: Mon-Khmer: North.@Austroasiatic: Mon-Khmer: East 0@Austroasiatic: Mon-Khmer: South1@(Austronesian: Malayo-Polynesian: Western 2@4Austronesian: Malayo-Polynesian: Central and Eastern 3@Na-Dene: Athabaskan-Eyak: Eyak 4@$Na-Dene: Athabaskan-Eyak: Athabaskan 5@Uto-Aztecan: Southern: Pimic 6@(Uto-Aztecan: Southern: Corrachol-Aztecan 7@ Tupi-Carib: Tupian: Tupi-Guarani 8@Tupi-Carib: Tupian: Munduruku  Not Confident ? Confident no ?yes  0134679:ABC?island @mainland @ peninsula ;<=> 0 (absent) ?1 (deep Islamization) @2 (deep Christianization) ] 0 (absent) ?1 (deep Islamization) @2 (deep Christianization) @3 (superficial Islamization) @ 4 (superficial Christianization) @5 (Mahayana Buddhism) @6 (Hinayana Buddhism) @7 (Vajrayana Buddhism) @ 8 (Hinduism) ^?7Classical religion (Xianity, Islam, Hinduism, Buddhism)@#Mixture of classical & preclassical @ Preclassical _?1,4,5,6@ Regions 2&3 i?1,5,6 @ Regions 2,3,4 j?4,5,6 @ Regions 1,2,3 k?5,6 @Regions 1,2,3,4l?2,3 @Regions 1,4,5,6m? Very High @High @ Quite High @Moderate @Little @None p?Very Low @Low @ Low-Medium @Medium @ Hi-Medium @High @ Very High r? Very High @High @ Quite High @Moderate @Little @None s?Very Low @Low @ Low-Medium @Medium @ Hi-Medium @High @ Very High t?Women's Groups?@Low FIGs @ Med-Low FIGS @ Medium FIGs @ Med-Hi FIGS @High Fraternal Interest Groups v?Low Female power @Lo-Med Female power @Medium Female power @Hi-med Female power @High Female power x?Very low Male Aggression @Low Male Aggression @Lo-Med Male Aggression @Medium Male Aggression @Hi-Med Male Aggression @High Male Aggression @ z?VLo @Lo @Lo-Med @Med. @Hi-Med @Hi @VHi @Highest|?V Low Pol Integ@Low @Low Med Pol Integ @Medium @Hi MedPol Integ@High @V Hi Pol Integ ~Not Patrilocal (v63) @Patrilocal (v63) ?7Classical religion (Xianity, Islam, Hinduism, Buddhism)@#Mixture of classical & preclassical @ Preclassical                                                                     `WSCCS#=sccs# SOCNAME=socname LATITUDE=latitude LONGITUD=longitud OUTLINEF=outlinefill AGRICSYS=AgricSystemPryor V7_A=AgricSysReliability STATEHOO=statehoodKoro V0_STATE=v0_StatesPaige V1=v1 V2=v2 V3=v3 V4=v4 V5=v5 V6=v6 V7=v7 V8=v8 V9=v9 V10=v10 V11=v11 V12=v12 V13=v13 V14=v14 V15=v15 V16=v16 V17=v17 V18=v18 V19=v19 V20=v20 V21=v21 V22=v22 V23=v23 V24=v24 V25=v25 V26=v26 V27=v27 V28=v28 V29=v29 V30=v30 V31=v31 V32=v32 V33=v33 V34=v34 V35=v35 V36=v36 V37=v37 V38=v38 V39=v39 V40=v40 V41=v41 V42=v42 V43=v43 V44=v44 V45=v45 V46=v46 V47=v47 V48=v48 V49=v49 V50=v50 V51=v51 V52=v52 V53=v53 V54=v54 V55=v55 V56=v56 V57=v57 V58=v58 V59=v59 V60=v60 V61=v61 V62=v62 V63=v63 V64=v64 V65=v65 V66=v66 V67=v67 V68=v68 V69=v69 V70=v70 V71=v71 V72=v72 V73=v73 V74=v74 V75=v75 V76=v76 V77=v77 V78=v78 V79=v79 V80=v80 V81=v81 V82=v82 V83=v83 V84=v84 V85=v85 V86=v86 V87=v87 V88=v88 V89=v89 V90=v90 V91=v91 V92=v92 V93=v93 V94=v94 V95=v95 V96=v96 V97=v97 V98=v98 V99=v99 V100=v100 V101=v101 V102=v102 V103=v103 V104=v104 V105=v105 V106=v106 V107=v107 V108=v108 V109=v109 V110=v110 V111=v111 V112=v112 V113=v113 V114=v114 V115=v115 V116=v116 V117=v117 V118=v118 V119=v119 V120=v120 V121=v121 V122=v122 V123=v123 V124=v124 V125=v125 V126=v126 V127=v127 V128=v128 V129=v129 V130=v130 V131=v131 V132=v132 V133=v133 V134=v134 V135=v135 V136=v136 V137=v137 V138=v138 V139=v139 V140=v140 V141=v141 V142=v142 V143=v143 V144=v144 V145=v145 V146=v146 V147=v147 V148=v148 TOTSEXLA=totsexla FOCYEAR=focyear V149=v149 V150=v150 V151=v151 V152=v152 V153=v153 V154=v154 V155=v155 V156=v156 V157=v157 V158=v158 V158.1MO=v158.1Modernization V159=v159 V160=v160 V161=v161 V162=v162 V163=v163 V164=v164 V165=v165 V166=v166 V167=v167 V168=v168 V169=v169 V170=v170 V171=v171 V172=v172 V173=v173 V174=v174 V175=v175 V176=v176 V177=v177 V178=v178 V179=v179 V180=v180 V181=v181 V182=v182 V183=v183 V184=v184 V185=v185 V186=v186 V187=v187 V188=v188 V189=v189 V190=v190 V191=v191 V192=v192 V193=v193 V194=v194 V195=v195 V196=v196 V197=v197 V198=v198 V199=v199 V200=v200 V201=v201 V202=v202 V203=v203 V204=v204 V205=v205 V206=v206 V207=v207 V208=v208 V209=v209 V210=v210 V211=v211 V212=v212 V213=v213 V214=v214 V215=v215 V216=v216 V217=v217 V218=v218 V219=v219 V220=v220 V221=v221 V222=v222 V223=v223 V224=v224 V225=v225 V226=v226 V227=v227 V228=v228 V229=v229 V230=v230 V231=v231 V232=v232 V233=v233 V234=v234 V235=v235 V236=v236 V237=v237 V238=v238 V239=v239 V240=v240 V241=v241 V242=v242 V243=v243 V244=v244 V245=v245 V246=v246 V247=v247 V248=v248 V249=v249 V250=v250 V251=v251 V252=v252 V253=v253 V254=v254 V255=v255 V256=v256 V257=v257 V258=v258 V259=v259 V260=v260 V261=v261 V262=v262 V263=v263 V264=v264 V265=v265 V266=v266 V267=v267 V268=v268 V269=v269 V270=v270 V271=v271 V272=v272 V273=v273 V274=v274 V275=v275 V276=v276 V277=v277 V278=v278 V279=v279 V280=v280 V281=v281 V282=v282 V283=v283 V284=v284 V285=v285 V286=v286 V287=v287 V288=v288 V289=v289 V290=v290 V291=v291 V292=v292 V293=v293 V294=v294 V295=v295 V296=v296 V297=v297 V298=v298 V299=v299 V300=v300 V301=v301 V302=v302 V303=v303 V304=v304 V305=v305 V306=v306 V307=v307 V308=v308 V309=v309 V310=v310 V311=v311 V312=v312 V313=v313 V314=v314 V315=v315 V316=v316 V317=v317 V318=v318 V319=v319 V320=v320 V321=v321 V322=v322 V323=v323 V324=v324 V325=v325 V326=v326 V327=v327 V328=v328 V329=v329 V330=v330 V331=v331 V332=v332 V333=v333 V334=v334 V335=v335 V336=v336 V337=v337 V338=v338 V339=v339 V340=v340 V341=v341 V342=v342 V343=v343 V344=v344 V345=v345 V346=v346 V347=v347 V348=v348 V349=v349 V350=v350 V351=v351 V352=v352 V353=v353 V354=v354 V355=v355 V356=v356 V357=v357 V358=v358 V359=v359 V360=v360 V361=v361 V362=v362 V363=v363 V364=v364 V365=v365 V366=v366 V367=v367 V368=v368 V369=v369 V370=v370 V371=v371 V372=v372 V373=v373 V374=v374 V375=v375 V376=v376 V377=v377 V378=v378 V379=v379 V380=v380 V381=v381 V382=v382 V383=v383 V384=v384 V385=v385 V386=v386 V387=v387 V388=v388 V389=v389 V390=v390 V391=v391 V392=v392 V393=v393 V394=v394 V395=v395 V396=v396 V397=v397 V398=v398 V399=v399 V400=v400 V401=v401 V402=v402 V403=v403 V404=v404 V405=v405 V406=v406 V407=v407 V408=v408 V409=v409 V410=v410 V411=v411 V412=v412 V413=v413 V414=v414 V415=v415 V416=v416 V417=v417 V418=v418 V419=v419 V420=v420 V421=v421 V422=v422 V423=v423 V424=v424 V425=v425 V426=v426 V427=v427 V428=v428 V429=v429 V430=v430 V431=v431 V432=v432 V433=v433 V434=v434 V435=v435 V436=v436 V437=v437 V438=v438 V439=v439 V440=v440 V441=v441 V442=v442 V443=v443 V444=v444 V445=v445 V446=v446 V447=v447 V448=v448 V449=v449 V450=v450 V451=v451 V452=v452 V453=v453 V454=v454 V455=v455 V456=v456 V457=v457 V458=v458 V459=v459 V460=v460 V461=v461 V462=v462 V463=v463 V464=v464 V465=v465 V466=v466 V467=v467 V468=v468 V469=v469 V470=v470 V471=v471 V472=v472 V473=v473 V474=v474 V475=v475 V476=v476 V477=v477 V478=v478 V479=v479 V480=v480 V481=v481 V482=v482 V483=v483 V484=v484 V485=v485 V486=v486 V487=v487 V488=v488 V489=v489 V490=v490 V491=v491 V492=v492 V493=v493 V494=v494 V495=v495 V496=v496 V497=v497 V498=v498 V499=v499 V500=v500 V501=v501 V502=v502 V503=v503 V504=v504 V505=v505 V506=v506 V507=v507 V508=v508 V509=v509 V510=v510 V511=v511 V512=v512 V513=v513 V514=v514 V515=v515 V516=v516 V517=v517 V518=v518 V519=v519 V520=v520 V521=v521 V522=v522 V523=v523 V524=v524 V525=v525 V526=v526 V527=v527 V528=v528 V529=v529 V530=v530 V531=v531 V532=v532 V533=v533 V534=v534 V535=v535 V536=v536 V537=v537 V538=v538 V539=v539 V540=v540 V541=v541 V542=v542 V543=v543 V544=v544 V545=v545 V546=v546 V547=v547 V548=v548 V549=v549 V550=v550 V551=v551 V552=v552 V553=v553 V554=v554 V555=v555 V556=v556 V557=v557 V558=v558 V559=v559 V560=v560 V561=v561 V562=v562 V563=v563 V564=v564 V565=v565 V566=v566 V567=v567 V568=v568 V569=v569 V570=v570 V571=v571 V572=v572 V573=v573 V574=v574 V575=v575 V576=v576 V577=v577 V578=v578 V579=v579 V580=v580 V581=v581 V582=v582 V583=v583 V584=v584 V585=v585 V586=v586 V587=v587 V588=v588 V589=v589 V590=v590 V591=v591 V592=v592 V593=v593 V594=v594 V595=v595 V596=v596 V597=v597 V598=v598 V599=v599 V600=v600 V601=v601 V602=v602 V603=v603 V604=v604 V605=v605 V606=v606 V607=v607 V608=v608 V609=v609 V610=v610 V611=v611 V612=v612 V613=v613 V614=v614 V615=v615 V616=v616 V617=v617 V618=v618 V619=v619 V620=v620 V621=v621 V622=v622 V623=v623 V624=v624 V625=v625 V626=v626 V627=v627 V628=v628 V629=v629 V630=v630 V631=v631 V632=v632 V633=v633 V634=v634 V635=v635 V636=v636 V637=v637 V638=v638 V639=v639 V640=v640 V641=v641 V642=v642 V643=v643 V644=v644 V645=v645 V646=v646 V647=v647 V648=v648 V649=v649 V650=v650 V651=v651 V652=v652 V653=v653 V654=v654 V655=v655 V656=v656 V657=v657 V658=v658 V659=v659 V660=v660 V661=v661 V662=v662 V663=v663 V664=v664 V665=v665 V666=v666 V667=v667 V668=v668 V669=v669 V670=v670 V671=v671 V672=v672 V673=v673 V674=v674 V675=v675 V676=v676 V677=v677 V678=v678 V679=v679 V680=v680 V681=v681 V682=v682 V683=v683 V684=v684 V685=v685 V686=v686 V687=v687 V688=v688 V689=v689 V690=v690 V691=v691 V692=v692 V693=v693 V694=v694 V695=v695 V696=v696 V697=v697 V698=v698 V699=v699 V700=v700 V701=v701 V702=v702 V703=v703 V704=v704 V705=v705 V706=v706 V707=v707 V708=v708 V709=v709 V710=v710 V711=v711 V712=v712 V713=v713 V714=v714 V715=v715 V716=v716 V717=v717 V718=v718 V719=v719 V720=v720 V721=v721 V722=v722 V723=v723 V724=v724 V725=v725 V726=v726 V727=v727 V728=v728 V729=v729 V730=v730 V731=v731 V732=v732 V733=v733 V734=v734 V735=v735 V736=v736 V737=v737 V738=v738 V739=v739 V740=v740 V741=v741 V742=v742 V743=v743 V744=v744 V745=v745 V746=v746 V747=v747 V748=v748 V749=v749 V750=v750 V751=v751 V752=v752 V753=v753 V754=v754 V755=v755 V756=v756 V757=v757 V758=v758 V759=v759 V760=v760 V761=v761 V762=v762 V763=v763 V764=v764 V765=v765 V766=v766 V767=v767 V768=v768 V769=v769 V770=v770 V771=v771 V772=v772 V773=v773 V774=v774 V775=v775 V776=v776 V777=v777 V778=v778 V779=v779 V780=v780 V781=v781 V782=v782 V783=v783 V784=v784 V785=v785 V786=v786 V787=v787 V788=v788 V789=v789 V790=v790 V791=v791 V792=v792 V793=v793 V794=v794 V795=v795 V796=v796 V797=v797 V798=v798 V799=v799 V800=v800 V801=v801 V802=v802 V803=v803 V804=v804 V805=v805 V806=v806 V807=v807 V808=v808 V809=v809 V810=v810 V811=v811 V812=v812 V813=v813 V814=v814 V815=v815 V816=v816 V817=v817 V818=v818 V819=v819 V820=v820 V821=v821 V822=v822 V823=v823 V824=v824 V825=v825 V826=v826 V827=v827 V828=v828 V829=v829 V830=v830 V831=v831 V832=v832 V833.1=v833.1 V833.2=v833.2 V833=v833 V834=v834 V835=v835 V836=v836 V837=v837 V838=v838 V840=v840 V841=v841 V842=v842 V843=v843 V844=v844 V854=v854 V855=v855 V856=v856 V857=v857 V858=v858 V859=v859 V859.1=v859.1 V860=v860 V861=v861 V862=v862 V863=v863 V864=v864 V865=v865 V866=v866 V867=v867 V868=v868 V869=v869 NAME=Name V870=v870 V871=v871 V872=v872 V873=v873 V874=v874 VA875=va875 V875=v875 V876=v876 V877=v877 V878=v878 V879=v879 V880=v880 V881=v881 V882=v882 V883=v883 V884=v884 V885=v885 V886=v886 V887=v887 V889=v889 V890=v890 V888=v888 V891=v891 V892=v892 V893=v893 V894=v894 V895=v895 V896=v896 V897=v897 V898=v898 V899=v899 V900=v900 V901=v901 V902=v902 V903=v903 V904=v904 V905=v905 V906=v906 V907=v907 V908=v908 V909=v909 V910=v910 V911=v911 V912=v912 V913=v913 V914=v914 V915=v915 V916=v916 V917=v917 V918=v918 V919=v919 V920=v920 V921=v921 V922=v922 V923=v923 V924=v924 V925=v925 V926=v926 V927=v927 V928=v928 V929=v929 V930=v930 V931=v931 V932=v932 V933=v933 V934=v934 V935=v935 V936=v936 V937=v937 V938=v938 V939=v939 V940=v940 V941=v941 V942=v942 V943=v943 V944=v944 V945=v945 V946=v946 V947=v947 V948=v948 V949=v949 V950=v950 V951=v951 V952=v952 V953=v953 V954=v954 V955=v955 V956=v956 V957=v957 V958=v958 V959=v959 V960=v960 V961=v961 V962=v962 V963=v963 V964=v964 V965=v965 V966=v966 V967=v967 V968=v968 V969=v969 V970=v970 V971=v971 V972=v972 V973=v973 V974=v974 V975=v975 V976=v976 V977=v977 V978=v978 V979=v979 V980=v980 V981=v981 V982=v982 V983=v983 V984=v984 V985=v985 V986=v986 V987=v987 V988=v988 V989=v989 V990=v990 V991=v991 V992=v992 V993=v993 V994=v994 V995=v995 V996=v996 V997=v997 V998=v998 V999=v999 V1000=v1000 V1001=v1001 V1002=v1002 V1003=v1003 V1004=v1004 V1005=v1005 V1006=v1006 V1007=v1007 V1008=v1008 V1009=v1009 V1010=v1010 V1011=v1011 V1012=v1012 V1013=v1013 V1014=v1014 V1015=v1015 V1016=v1016 V1017=v1017 V1018=v1018 V1019=v1019 V1020=v1020 V1021=v1021 V1022=v1022 V1023=v1023 V1025=v1025 V1026=v1026 V1027=v1027 V1028=v1028 V1029=v1029 V1030=v1030 V1031=v1031 V1032=v1032 V1033=v1033 V1034=v1034 V1035=v1035 V1036=v1036 V1037=v1037 V1038=v1038 V1039=v1039 V1040=v1040 V1042=v1042 V1043=v1043 V1044=v1044 V1045=v1045 V1046=v1046 V1047=v1047 V1048=v1048 V1049=v1049 V1050=v1050 V1051=v1051 V1052=v1052 V1053=v1053 V1054=v1054 V1055=v1055 V1056=v1056 V1057=v1057 V1058=v1058 V1059=v1059 V1060=v1060 V1061=v1061 V1062=v1062 V1063=v1063 V1064=v1064 V1065=v1065 V1066=v1066 V1072=v1072 V1073=v1073 V1074=v1074 V1075=v1075 V1076=v1076 V1077=v1077 V1078=v1078 V1079=v1079 V1080=v1080 V1081=v1081 V1082=v1082 V1083=v1083 V1084=v1084 V1085=v1085 NUMBER=number V1086=v1086 V1087=v1087 V1088=v1088 V1089=v1089 V1090=v1090 V1091=v1091 V1092=v1092 V1093=v1093 V1094=v1094 V1095=v1095 V1096=v1096 V1097=v1097 V1100=v1100 V1101=v1101 V1102=v1102 V1103=v1103 V1104=v1104 V1105=v1105 V1106=v1106 V1107=v1107 V1108=v1108 V1110=v1110 V1111=v1111 V1112=v1112 V1116=v1116 V1117=v1117 V1118=v1118 V1119=v1119 V1120=v1120 V1121=v1121 V1122=v1122 V1123=v1123 V1124=v1124 V1125=v1125 V1126=v1126 V1127=v1127 V1128=v1128 V1129=v1129 V1130=v1130 V1131=v1131 V1132=v1132 V1133=v1133 V1134=v1134 V1135=v1135 V1136=v1136 V1137=v1137 V1138=v1138 V1139=v1139 V1140=v1140 V1141=v1141 V1142=v1142 V1143=v1143 V1144=v1144 V1145=v1145 V1146=v1146 V1147=v1147 V1148=v1148 V1149=v1149 V1150=v1150 V1151=v1151 V1152=v1152 V1153=v1153 V1154=v1154 V1155=v1155 V1156=v1156 V1157=v1157 V1158=v1158 V1159=v1159 V1160=v1160 V1161=v1161 V1162=v1162 V1163=v1163 V1164=v1164 V1165=v1165 V1166=v1166 V1167=v1167 V1168=v1168 V1169=v1169 V1170=v1170 V1171=v1171 V1172=v1172 V1173=v1173 V1174=v1174 V1175=v1175 V1176=v1176 V1177=v1177 V1178=v1178 V1188=v1188 V1189=v1189 V1190=v1190 V1191=v1191 V1192=v1192 V1193=v1193 V1194=v1194 V1195=v1195 V1196=v1196 V1197=v1197 V1198=v1198 V1199=v1199 V1200=v1200 V1201=v1201 V1202=v1202 V1203=v1203 V1204=v1204 V1205=v1205 V1206=v1206 V1207=v1207 V1208=v1208 V1209=v1209 V1210=v1210 V1211=v1211 V1212=v1212 V1213=v1213 V1214=v1214 V1215=v1215 V1216=v1216 V1217=v1217 V1218=v1218 V1219=v1219 V1220=v1220 V1221=v1221 V1222=v1222 V1223=v1223 V1224=v1224 V1225=v1225 V1226=v1226 V1227=v1227 V1228=v1228 V1229=v1229 V1230=v1230 V1231=v1231 V1232=v1232 V1233=v1233 V1234=v1234 V1235=v1235 V1236=v1236 V1237=v1237 V1248=v1248 V1249=v1249 V1250=v1250 V1251=v1251 V1253=v1253 V1254=v1254 V1255=v1255 V1256=v1256 V1257=v1257 V1258=v1258 V1259=v1259 V1260=v1260 V1261=v1261 V1262=v1262 V1263=v1263 V1264=v1264 V1265=v1265 V1266=v1266 V1267=v1267 V1268=v1268 V1269=v1269 V1270=v1270 V1271=v1271 V1272=v1272 V1273=v1273 V1274=v1274 V1275=v1275 V1276=v1276 V1277=v1277 V1278=v1278 V1279=v1279 V1280=v1280 V1281=v1281 V1282=v1282 V1283=v1283 V1284=v1284 V1285=v1285 V1286=v1286 V1287=v1287 V1288=v1288 V1289=v1289 V1290=v1290 V1291=v1291 V1292=v1292 V1293=v1293 V1294=v1294 V1295=v1295 V1296=v1296 V1297=v1297 V1298=v1298 V1299=v1299 V1300=v1300 V1301=v1301 V1302=v1302 V1303=v1303 V1304=v1304 V1305=v1305 V1306=v1306 V1307=v1307 V1308=v1308 V1309=v1309 V1310=v1310 V1311=v1311 V1312=v1312 V1313=v1313 V1314=v1314 V1315=v1315 V1316=v1316 V1317=v1317 V1318=v1318 V1319=v1319 V1320=v1320 V1321=v1321 V1322=v1322 V1323=v1323 V1324=v1324 V1325=v1325 V1326=v1326 V1327=v1327 V1328=v1328 V1329=v1329 V1330=v1330 V1331=v1331 V1332=v1332 V1333=v1333 V1334=v1334 V1335=v1335 V1336=v1336 V1337=v1337 V1338=v1338 V1339=v1339 V1340=v1340 V1341=v1341 V1342=v1342 V1343=v1343 V1344=v1344 V1345=v1345 V1346=v1346 V1347=v1347 V1348=v1348 V1349=v1349 V1350=v1350 V1351=v1351 V1352=v1352 V1353=v1353 V1354=v1354 V1355=v1355 V1356=v1356 V1357=v1357 V1358=v1358 V1359=v1359 V1360=v1360 V1361=v1361 V1362=v1362 V1363=v1363 V1364=v1364 V1365=v1365 V1366=v1366 V1367=v1367 V1368=v1368 V1369=v1369 V1370=v1370 V1371=v1371 V1372=v1372 V1373=v1373 V1374=v1374 V1375=v1375 V1376=v1376 V1377=v1377 V1378=v1378 V1379=v1379 V1380=v1380 V1381=v1381 V1382=v1382 V1383=v1383 V1384=v1384 V1385=v1385 V1386=v1386 V1387=v1387 V1388=v1388 V1389=v1389 V1390=v1390 V1391=v1391 V1392=v1392 V1393=v1393 V1394=v1394 V1395=v1395 V1396=v1396 V1397=v1397 V1398=v1398 V1399=v1399 V1400=v1400 V1401=v1401 V1402=v1402 V1403=v1403 V1404=v1404 V1405=v1405 V1406=v1406 V1407=v1407 V1408=v1408 V1409=v1409 V1410=v1410 V1411=v1411 V1412=v1412 V1413=v1413 V1414=v1414 V1415=v1415 V1416=v1416 V1417=v1417 V1418=v1418 V1419=v1419 V1420=v1420 V1421=v1421 V1422=v1422 V1423=v1423 V1424=v1424 V1425=v1425 V1426=v1426 V1427=v1427 V1428=v1428 V1429=v1429 V1430=v1430 V1431=v1431 V1432=v1432 V1433=v1433 V1434=v1434 V1435=v1435 V1436=v1436 V1437=v1437 V1438=v1438 V1439=v1439 V1440=v1440 V1441=v1441 V1442=v1442 V1443=v1443 V1444=v1444 V1445=v1445 V1446=v1446 V1447=v1447 V1448=v1448 V1449=v1449 V1450=v1450 V1451=v1451 V1452=v1452 V1453=v1453 V1454=v1454 V1455=v1455 V1456=v1456 V1457=v1457 V1458=v1458 V1459=v1459 V1460=v1460 V1461=v1461 V1462=v1462 V1463=v1463 V1464=v1464 V1465=v1465 V1466=v1466 V1467=v1467 V1468=v1468 V1469=v1469 V1470=v1470 V1471=v1471 V1472=v1472 V1473=v1473 V1474=v1474 V1475=v1475 V1476=v1476 V1477=v1477 V1478=v1478 V1479=v1479 V1480=v1480 V1481=v1481 V1482=v1482 V1483=v1483 V1484=v1484 V1485=v1485 V1486=v1486 V1487=v1487 V1488=v1488 V1489=v1489 V1490=v1490 V1491=v1491 V1492=v1492 V1493=v1493 V1494=v1494 V1495=v1495 V1496=v1496 V1497=v1497 V1498=v1498 V1499=v1499 V1500=v1500 V1501=v1501 V1502=v1502 V1503=v1503 V1504=v1504 V1505=v1505 V1506=v1506 V1507=v1507 V1508=v1508 V1509=v1509 V1510=v1510 V1511=v1511 V1512=v1512 V1513=v1513 V1514=v1514 V1515=v1515 V1516=v1516 V1517=v1517 V1518=v1518 V1519=v1519 V1520=v1520 V1521=v1521 V1522=v1522 V1523=v1523 V1524=v1524 V1525=v1525 V1526=v1526 V1527=v1527 V1528=v1528 V1529=v1529 V1530=v1530 V1531=v1531 V1532=v1532 V1533=v1533 V1534=v1534 V1535=v1535 V1536=v1536 V1537=v1537 V1538=v1538 V1539=v1539 V1540=v1540 V1541=v1541 V1542=v1542 V1543=v1543 V1544=v1544 V1545=v1545 V1546=v1546 V1547=v1547 V1548=v1548 V1549=v1549 V1550=v1550 V1551=v1551 V1552=v1552 V1553=v1553 V1554=v1554 V1555=v1555 V1556=v1556 V1557=v1557 V1592=v1592 V1593=v1593 V1594=v1594 V1595=v1595 V1596=v1596 V1597=v1597 V1598=v1598 V1599=v1599 V1600=v1600 V1601=v1601 V1602=v1602 V1603=v1603 V1604=v1604 V1605=v1605 V1606=v1606 V1607=v1607 V1608=v1608 V1609=v1609 V1610=v1610 V1611=v1611 V1612=v1612 V1613=v1613 V1614=v1614 V1615=v1615 V1616=v1616 V1617=v1617 V1618=v1618 V1619=v1619 V1620=v1620 V1621=v1621 V1622=v1622 V1623=v1623 V1624=v1624 V1625=v1625 V1626=v1626 V1627=v1627 V1628=v1628 V1629=v1629 V1630=v1630 V1631=v1631 V1632=v1632 V1633=v1633 V1634=v1634 V1635=v1635 V1636=v1636 V1637=v1637 V1638=v1638 V1639=v1639 V1640=v1640 V1641=v1641 V1642=v1642 V1643=v1643 V1644=v1644 V1645=v1645 V1646=v1646 V1647=v1647 V1648=v1648 V1649=v1649 V1650=v1650 V1651=v1651 V1652=v1652 V1653=v1653 V1654=v1654 V1655=v1655 V1656=v1656 V1657=v1657 V1658=v1658 V1659=v1659 V1660=v1660 V1661=v1661 V1662=v1662 V1663=v1663 V1664=v1664 V1665=v1665 V1666=v1666 V1667=v1667 V1668=v1668 V1669=v1669 V1670=v1670 V1671=v1671 V1672=v1672 V1673=v1673 V1674=v1674 V1675=v1675 V1676=v1676 V1677=v1677 V1678=v1678 V1679=v1679 V1680=v1680 V1681=v1681 V1682=v1682 V1683=v1683 V1684=v1684 V1685=v1685 V1686=v1686 V1687=v1687 V1688=v1688 V1689=v1689 V1691=v1691 V1692=v1692 V1693=v1693 V1694=v1694 V1695=v1695 V1696=v1696 V1697=v1697 V1698=v1698 V1699=v1699 V1700=v1700 V1701=v1701 V1702=v1702 V1703=v1703 V1704=v1704 V1705=v1705 V1706=v1706 V1707=v1707 V1708=v1708 V1709=v1709 V1710=v1710 V1711=v1711 V1712=v1712 V1713=v1713 V1714=v1714 V1715=v1715 V1716=v1716 V1717=v1717 V1718=v1718 V1719=v1719 V1720=v1720 V1721=v1721 V1722=v1722 V1723=v1723 V1724=v1724 V1725=v1725 V1726=v1726 V1727=v1727 V1728=v1728 V1729=v1729 V1730=v1730 V1731=v1731 V1732=v1732 V1733=v1733 V1734=v1734 V1735=v1735 V1736=v1736 V1737=v1737 V1738=v1738 V1739=v1739 V1740=v1740 V1741=v1741 V1742=v1742 V1743=v1743 V1744=v1744 V1745=v1745 V1746=v1746 V1747=v1747 V1748=v1748 V1749=v1749 V1750=v1750 V1751=v1751 V1752=v1752 V1753=v1753 V1754=v1754 V1755=v1755 V1756=v1756 V1757=v1757 V1758=v1758 V1759=v1759 V1760=v1760 V1761=v1761 V1762=v1762 V1763=v1763 V1764=v1764 V1765=v1765 V1766=v1766 V1767=v1767 V1768=v1768 V1769=v1769 V1770=v1770 V1771=v1771 V1772=v1772 V1773=v1773 V1774=v1774 V1775=v1775 V1776=v1776 V1777=v1777 V1778=v1778 V1779=v1779 V1780=v1780 OWC=owc SCCS=sccs SOCIETY=society V1781=v1781 V1782=v1782 V1783=v1783 V1784=v1784 V1785=v1785 V1786=v1786 V1787=v1787 V1788=v1788 V1789=v1789 V1790=v1790 V1791=v1791 V1792=v1792 V1793=v1793 V1794=v1794 V1795=v1795 V1796=v1796 V1797=v1797 V1798=v1798 V1799=v1799 V1800=v1800 V1801=v1801 V1802=v1802 V1803=v1803 V1804=v1804 V1805=v1805 FACT_1=fact_1 FACT_2=fact_2 FACT_3=fact_3 FACT_4=fact_4 FACT_5=fact_5 FACT_6=fact_6 FACT_7=fact_7 FACT_8=fact_8 V1806TRA=v1806trade1 V1807TRA=v1807trade2 V1808TRA=v1808trade3 V1809TEC=v1809tech1 V1810TEC=v1810tech2 V1811TEC=v1811tech3 V1812AGR=v1812agricul1 V1813AGR=v1813agricul2 V1814AGR=v1814agricul3 V1815TRA=v1815trans1 V1816TRA=v1816trans2 V1817TRA=v1817trans3 V1818GOV=v1818govt1 V1819GOV=v1819govt2 V1820GOV=v1820govt3 V1821GOV=v1821govt4 V1822FAM=v1822family1 V1823FAM=v1823family2 V1824FAM=v1824family3 V1825FAM=v1825family4 V1826TOL=v1826toliet1 V1827TOL=v1827toliet2 V1828BEH=v1828behav1 V1829BEH=v1829behav2 V1830EDU=v1830educa1 V1831EDU=v1831educa2 V1832EDU=v1832educa3 V1833HEA=v1833health1 V1834HEA=v1834health2 V1835HEA=v1835health3 V1836REL=v1836rel1 V1837REL=v1837rel2 V1838REL=v1838rel3 V1839SUM=v1839sumagr V1840SUM=v1840sumbehav V1841SUM=v1841sumedu V1842SUM=v1842sumfam V1843SUM=v1843sumgov V1795_A=v1843sumhealt V1844SUM=v1844sumrel V1845SUM=v1845sumtech V1846SUM=v1846sumtoile V1847SUM=v1847sumtrade V1848SUM=v1848sumtrans V1849SUM=v1849sumtotal V1850=v1850 V1851=v1851 V1852=v1852 V1853=v1853 V1854=v1854 V1855=v1855 V1856=v1856 V1857=v1857 V1858=v1858 V1859=v1859 V1860=v1860 V1861=v1861 V1862=v1862 V1863=v1863 SCCSNUM=sccsnum V1864=v1864 V1865=v1865 V1866=v1866 V1867=v1867 V1868=v1868 V1869=v1869 V1870=v1870 V1871=v1871 V1872=v1872 V1874=v1874 V1875=v1875 V1876=v1876 V1877=v1877 V1878=v1878 V1880=v1880 V1882=v1882 V1884=v1884 V1886=v1886 V1888=v1888 V1889=v1889 V1890=v1890 V1891=v1891 V1892=v1892 V1893=v1893 V1894=v1894 V1895=v1895 V1896=v1896 V1897=v1897 V1898=v1898 V1899=v1899 V1900=v1900 V1901=v1901 V1902=v1902 V1903=v1903 V1905=v1905 V1907=v1907 V1908=v1908 V1909=v1909 V1910=v1910 V1911=v1911 V1912=v1912 V1913=v1913 V1914=v1914 V1915=v1915 V1916=v1916 V1917=v1917 V19_22=v19_22 V24_25=v24_25 V26_27=v26_27 V53_54=v53_54 COMPLEX=complex V159_177=v159_177 FORTITUD=fortitud AGGRESSI=aggressi COMPETIV=competiv SELFRELY=selfrely ACHIEVEM=achievem INDUSTRY=industry RESPONSI=responsi OBEDIENC=obedienc SELFREST=selfrest SEXRESTR=sexrestr ID66=id66 V2001_18=v2001_1806 V2002_18=v2002_1807 V713REV=v713rev ISLAM=Islam CHRISTIA=Christian BUDDHIST=Buddhist HINDU=Hindu HINDUBUD=HinduBuddhist SHAMAN2=Shaman2 GAMESOFC=GamesOfChance GAMESOFS=GamesOfSkill V1891_A=GamesOfStrategy NOMEURAS=NomEurasia V1893_A=NomEurasiaPacific NOMAFROE=NomAfroEurasia NOMOLDWO=NomOldWorld NOMNEWWO=NomNewWorldAfroPacific EXTERNAL=ExternalWar13 V1898_A=ExternalWar50 V1899_A=ExternalWar50Bands INTERRNA=InterrnalWar46 V1901_A=InterrnalWar46Bands EXTWARFA=ExtWarFactor INTWARFA=IntWarFactor FRATINTG=FratIntGroups60 V1905_A=FratIntGroups60Bands FEMALEPO=FemalePower107 V1907_A=FemalePower107Bands MALEAGGR=MaleAggression50 V1909_A=MaleAggression50Bands MODERNIZ=Modernization102 V1911_A=Modernization102Bands POLITICA=PoliticalIntegration82 V1913_A=PoliticalIntegration82Band JURIS_LE=Juris_Levels123 V1915_A=Juris_Levels181 SIBL_IN=Sibl_in_law38 BR_SI__M=Br_Si__MBW_FZH18 WIMO_DAH=WiMo_DaHu__SoWi_HuFa39 MBD_FZS=MBD_FZS__FZD_MBS43 SEX_PERM=Sex_Permissive77 UNEQUALG=UnequalGender63 SCARIFIC=Scarification126 CLASSSTR=ClassStratification52 STATESYS=StateSystem48 SEXPERM=SexPerm_FemPower_NoUneqGend26 PATRILOC=Patrilocal V1927_A=Patrilocal_UnequalGender63 FAMILYTR=FamilyTrust54 HOTDRY=HotDry V247A=v247A R247AV53=R247Av53 R247AV=R247Av MALEDOMI=MaleDominance53v53 V1934_A=MaleDominance53Nov53 MONOGAMY=Monogamy_Dowry V1936_A=MonogamyDowryFemaleLabor V713KORO=v713koroeuNama Hottentot ;deheeikehggefefeeeeeeihehhgefghfghfhgeijgefhfhggggeehgegegfgggihfhikggfhffeffhfgegfdicceeceeedddddceiiecciiiihddeiccheiieeceegcchdg@eeefhfeegfvfeffehheffvguy`@qjdmepkedeegegeidheffkgglenhjmhmemmmgmhmgeeegffelgdfekfheemijmgmmmmmmjeegmmmmmfmemeeeeekhhfffkgiiffigffiigglghhhhffhjffjiiiiiffhhjggggggfheeffjjggggeiffffkkkkiiiiggggeekejgggeeekejhiieggggkkkkjjjjjjjjjjjjjjjjjjjjhhhhiiiikjjiiiiijhjhggijhjjjffjhffhhgggghgiijjgfggiigfhhffggfefeeeeffggfeeeeeeefffeeifgfghhghffffkffhfggeeeffhheeeffeffhfffhfeghgggfefeffefgfeffeeefehgefffffejffefjfjgjgggefffeeeffeeffffieeehgfeeeefffeffffgfgfihgfgffeffifhfghjgeggfhhhfggieegjhfim(@`{@/$?eeeeddifd}~liiieeuh;dfhe@FX13 Aa 3 ekefjoA01 a ggfgeegdddeipNama Hottentot ggeed@@edddd~hffffegfeeeffeeffhffeefeefclddphdidgdgeddddddljjjmgdijefffeddehgeddddeddddedddeeededdeedeeddddddedddddddddddefddee@deeedeedddgf@eedddddeeegdehddddfdheeedddgdddddddddddddddddddddddddddddddddddddddgdggdeddddddddddddddddffjjjjekgjeeeeeeflgfghhhffddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddehehdeedgghefgffeffdddehehdeedgghefgffffdddddddfehheefeiggggifeeffeiiiffefeieiiffefeiiffefevuueelejiilonelgleeeeleelfgeelfegfieeeeeeeeeeeeeifedFX13 1 Nama (Hottentot)dddddddddddddddddefdfddgfddddddddeeeedddeeddedddeeedeeeeedddeddeeefegeeffffeveeeeeeeeeeedgeeddddddefgdddeiikophddhedhedhedffff26.50S 17.10E eeex@(\O&@fffffN@ffffff?hiljvsfffff<@nprutrsxpddgdNama Hottentot ddddefffeefffhiD?;@?et鿴 &?X>}e$?V#9?gep|E=?hgf_ zK!@ &a?tE?Kung Busehmen h|?3Gz4@feeehgijeefeeeeeeleeiigffiehfefeefeilgehfhffhhmifieeheegeglhihhgggkgghhgeeeeeeeeeedhedeedeeddddddcddieeddhdgdieddddddgeedeeddeedeehdifex@eeeeeefepgheggghzfzgx|y}s@`}@gdkekjedeeelfdddfmklfgghfnhhmememfmlmhmkeeeegegfgdfeeeejmmemmjmmmmmmiemmmmmmmememeeeeeeeffflefilfggjjffiiddffggjjggjjffijeehjffjjggjjjjjjlmngghhfhfheekkmgggiiiikfffghhhgigieeeeffffeeeeggeiggggnnnnmmmmggggjjjjhheeeekkkkiiiimmmmmmkkkkkkggjjlffffihfffggghghgihhjhfggiiggffffjgfefeeeeeeeeeeeeeghgihgifeeffeheefffffjffeefgeiggeeeiiegfheeeeefgkehgghhghgeghffegghegggghhhhgeggfegeeeeegei|@K7A`?@ffeefddd}ded}wffffkleh|?3Gz4@geex@FX10 Aa 1 A02 a ekefefgggfeededdenwefKung Bushmen edheddx@@dddwhggggfffggfghffffffefclddxldhdldhidljjjmgdiieeefddfdggfdddddddddeddddeededdeedddededddddddddddddddx@dddddddddddddfdx@ddggeeeddddeedddjgddddfdfeegdegdddhgddddddeeddddgdddddddddddddddddddddgdgggdgdeedddddeeddddddddddddddddddfeeffiiiiiifgkfjefgeeeeneghffdddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddjhhhddddddhhkhfffefehjhhhiehiegjeiheeeeeeekeeeeeeeeeeeeeeeeeeeeeghhlieffgggeeeeeeeeeefeekeffwjijfeedeedgedleeeeheedeeeddddddddeeg|ededehfgfhgeefeegidfdedddFX10 2 Kung (San) dddfddedffdfddfffffddihegdddddeedefddeddddeedddeeeeeeeeeededeedefggfefgffdyekefefeeeeedgefeeehilmmpjjos{fddfddfddgddffffdd19.50S 18.30E dxT@fffffA@K7QE@&@33333Q@@N@hfnlpyvrhvvsptv|ddgdddKung Bushmen ddfefeeefffj  c@X˜@jeih1G:w0;@?R76ѿe 8zB<q 0x-?q|'nۿ/?߈ G?8P?dhhewM;*?|E=?ggThonga h|?9eehev*@@jiggffggfiefhehekfegjeehggefhhhihhhgfhehifefhghffemgeheihejjelpgggihehikghifgggigeggehlhmihfeeeeeehhhiieeeieicidieideedeedeieedeeiiedheeehhe$@hegihgfeeefkgef|fg}~{|wЁ@ukfkkedefhdeegiemllhiilenhjmhgemmmimhmigjkfgliigekfjeemmjeegmmmmmjeeeimmmmhmemeeefekejfffhlgiijjffffjgjggggggiijhhiijjjjfffflifiiiifhfhjjjjggggiiiiggggiiffiiiiiiiiiiiieeeeeeeeiiggeeeejfjfjljleieiegegiiiimmmmkkkkjjjjjjkkkkkkggggggljljhhhhkkkkfiiillfffjjjjhhhffighghhgghhjhiifgggggifhhihhfjgeffeeeefgigffefgfggfeeehgffffgfggfffkffefgfeeeegfegffffefffffgeggeggfffegieghfffeefeghegegffffeeiffefjghegffgfeefeeeffeffegfeefgfffeehffeheigffffeehegggegfeghghiheeffjgggfefgeeggfi@(@leegeQ?ԝ@feeegiiiiijdidiiiiggghgheh|?9v*@@ef$@FT 6 Ab 4 A03 a eilniihgiffgdedThonga gef@@jdigegeegffeeeefehfffeffefclddtldhdhdhgdlemhheeijhehieeihkhhhiiekgfhefehhhfffghjiieihhgfjgjjjjeeirdedeeeidihdddddddhddgdddhdhdddddeedddddddddhddddddddkeedggfgeddddddedddeddddeeiihieijeffjeegfeefoefghhggffihhihihifffefefddeddddddgfdddihhihihifffefegjdeddddddgfdddjjeeeedeedhfeffefededffffeedeeefddedegieefdddddddejhhheifeiiiffeffhhffefffhifffffhiffihgffeefffdddkkkkeleleeeeehlhgllfefggeeeefeeegegfevegjieggfedgeeifgghhejhgglgegegpgeeefhhffeeggegegfgefleghefgffggFT06 3 ddfddThonga dddddddddddddedddddgdddddeddeeeeeeddeddeeeddeeeddeedeededddeeeefgfefgegexeeeeeeeeefgfndgefhkklnoqlruwy|hedhedhedhedffffeee25.40S 32.80E @xqf̼U@5^I B:@33333sG@33333s`@,U@khsnplvpwv|lThonga ddfdddddfffeefffgg+w?khh3>~c?Ϋʝ? ~?g=(?v?U)<?g!"S?T?CM_?^Uɱ׿elhH=.P? f¦ghTXLozi 7@ffheiihkgfghfieeheeepfghfhfegifegfgghihjflgghggjfhkkihfhegegjgfgejlifehcdeefeeeehhhheeiecidieiededcehceeiecddecchegegihge@egihhhksf{gnn|@{}vndЍ@@j@kpjhpdefgefefhgfiikggkeiegmememhflmhmlijgffhfdekfkiemejeggmmmmmiefeimmmmhmemheeekkfffffhlifllgiiiijjjjiifgijgggghhhhifiiiieieihhiieeeehhhhggggeeeeiiiiiiiijjjjhhhheieieeeeiieigghhjjjjjjhiiiijiihiiiiiiiijhhefdhdfdgdgdgdhdhdjdhdgdidgdhdhdgfegijjeeeffffjffegfffffefefieffefffeeggfggfeegffeeffghgeeegefeeeffehefe|@I +?{egfefeP@ee}}iiikdwdjhllffTehhje7@@FQ 9 efeiAb 3 A03 f olihfiffedddgLozi egjdhngfgeeeeeeeeeeffefseddyldjdkdjkdlhjjjdehsdedehehdjfeddeeddddheddddddhddddeeddddddhddeeddddeedddgdggfeeeddddddddddddddfefghhiiiihefgfgfgtfehhgfpokkkkeihhponlkleimhlkeellleeeelleeehefeggeeeeeeeegggggvfhlffgfegffghdggejedngfgfgpgfggh|fjgghegFQ09 4 Lozi ddddddddedddddddddedddddgdeddddddeeeefeeeddddeeddddddeeddedeeedeeefdfdffghfgdxeeeeeeeeefgfhdddfkmquwmrv|eddeddeddeddffffeeex17.47S 24.30E ԝ@(\rQ@yijt$7@Gz4I@\@QN@sx|ntptddLozi gdddddeefffhij yHK?1، Z?X:)l?Cz ??q 0x-?eU~l俒gŌrELu>A.?H=.P?hfegiMbundu (0@efjihkffgffeeehfgekfegmeeiigefhffgheehgijgefggggeghfgfjhghjgjggfgihegikghfhgfhgjfgehfkfiideeeeedfhhhhfedieidieiciceeeehecdieddeecgee@eihfhehghhfjhfifpfsgddvwș@udie(@`m@hfpdefieeefiemiikiileiejfgmgmmmgghkggjkhggfjdfekejfemljeegmmmmmjefeimmmmhmemheeekffffhlgggjjggggggjjffjjfhjkgijjjjjjiijijjjjhgghhggeiggkkhghghheieiiiffhhhiihihiiiiggeiggeijiiiffffgieieieigghhmmmmmmmmjjjjjjjjmmffjjjjiiiihhhhkkkkggllikkijkffiffiihghhhhhgjiifiiiiggiihhigiijjgfghffeeiffffeeggeffkffffeeeegfghgffffffeefffffegghgggfeeefekfeefeeeeefeggeffffeifffefjfgegfffeffeefefeefeffeheehhfffeehffegfjefgefgggeffffgfeghghhhegfffeigieit@l@-?ffeeff}iiidjjddiihhggg(0@dgle@FP13 Ab 4 @i@efeilnA04 a eihfieegdedgMbundu effgedP@d@dedeeikgffeeeefefefeeeffsgddwkdhdldhldkikkilejrdedehdidfgeehddeddddedhgdddddhhhdddddhdddddddddddddhhddfdefgeggfsffghdhgviukhjejlkponllhhilllelilelleleeeeellfggfeeefeeegfgegghegdFP13 5 Mbundu dddddddddddddddddegddddfedddddddeddedfddeeddeedddddeeeeeeeeeedeedefgefffgfeexeeeeeeeeefgfideeghjmpqeio{iddjddkedkedffff12.5S 16.30E eeexd@`@(\u7@33333J@qfnjwi@33333Sb@vpvtwx|y|ddfdMbundu dddddeffeefffjh5sm?FS?ʑ?K,0?gepH=.P?hgj3Vuh( f¦XSuku ^vfehgjhgeffghgjeeegefffejeffjggfgeggifefggheihfhkelmgeghhegilghhjgheiheggghhccdcefeedeiiiicddiedcdiicicedeeecdiedeecedeeh@hehehgigkegkefedjemiikiikeiegmemhmmmggheggikfghfjifegejgejegmmehimmhmemfefhgghhifgllgjjffiifigjfffillllhhggggggggffggeeeehhhhgggghhhhffffiiiiiiiijjjjiiiieeeeeeehhhhiiiieieieieieeeemmmmkkkkjmjklilillllggjjjhjjfeidhdhdhdhdjdgdkdfdgdidhdjdgdgdefeefefgfeeeeffeeeegefggffffffkfffeeheigefeehfeffggfggggfffeffgffffgggfffgffegegffv@h|?5?@eeeeiii}ij}dffihff^vgdhfd@Ac17 ؆@A05 a efeilnihfiffdddfeSuku fjdP@P@kxhddvldfdldfldlfmjheeiidighfiffhhigikfjhgjhfieegeihggegejhljhlj@eeedddddeddddh|dedeeehdgeeddddddddhddgddddddddddddddddddddddhfdddddddgdffgfgggvhhgfiiiiiiiiiiiihffffffffffffffeeeeeeeeeeeerddddddddddeidddiiiiiiiiiiiihffffffffffffffeeeeeeeeeeeeoddddddddddedddddddfdffddddddddddddddddddddddddddddddddmekeiifiiqlpikiehmlnmlegggikkgeegggeiieglllleeeleeeeggeegfefgeegeewxfifeedeedfdfdeffejhednfefeegegffjtffefgefeffefggeee 6 Suku efgfjhiknrux{gjov~eddeddeddfdeffffee6.10S 18.10E ex0@Gzd@p= c+@L`@Pk@fffffV@kkkjjrtolddgdddSuku ddeefffih;@?iiAX?jj _?(mD?<ɓQ}KBJK%C`?ghgeH=.P?gkBemba %ffe>@iigegfhggjefheeekfegiiigefhfgkghhefgegifeghfhfeemgghfihggjjileeghheeglghhgheiiekgiihhekiideefeedfghhicediecidieieieeeeeeeeedieedeefeidheffhhf@heefigeieenfg@nny{unx@dlejhed0q@eggeeedkfghhkgggfkegmemhmfmgghhggjhgggggdgegejkemljlggmmmmmiefimmmhmemfffhgghfefffhlgffiiiijjhhiihhljfgfgfgijfgfjffffffhhigggggggeieeeeggggggggggggiiiiiiiiffffggggfhfhggggeeeeeeeeffhgggjjhieiggeieeggkkkkjjjjjjjjjjjjkkkkjjjjggggiiijlljijjjjllllhikjlfefdgdfdhdgdgdgdhdjdidgdidfdgdidjfgfffgekfgfgeggffeekgfeggggegffijgfffeefifffggfggfgffgfffeffefefeefeeefeeeeeffffhfffeehffeggiggfefhegggeeeffehhghihjgggjfffegegifL@y@lf{Gz?feeffgixxxdhd}diilleegdhef%>@ef@FQ 5 Ac 3 A06 a eilnggggeeededBemba gfke@@eeeizseddxldhdldhldjllhdedeiqdedeedgdjgfedddddddeedddddddddedddddddddddddhddddddddddkeeggdgddddddffiiffehkheggggeesfifhhhfvuudddeogmponllleeeffgggeeeefeeeegggghhggFQ05 7 dedddBemba ffededddddddddeddddeefd @edededeegeeedddedeegfdddeedeededddeefefigefiefd|iiffffeeefgfdk@@dfkpvyejufdegdegdeideffffeee9.80S 29.08E ܝ@xq(\^@Dl+@ U@fffffb@ngfrzvzntqlpBemba ddgdddddeefffh(il?'=_?H?/?dS?߈ G??2EV?hfeH=.P?3ڿWp &a?gltE?Nyakyusa#eefjihkffgefieehfeeeefhhgefjfghefgifegggffhhiggijfggigghieegjhffeghgfffgehfdccdefeedeehiiieeiehchheiddddicecdddecdeecdifehifhe8@fhhehhifffefmfgrr @vxrlg@g@kejiedehjdeefjemiikiimfnhgmgmemfmlmhmgihkgfgfediekfkkelmleegmmmmmmefefmmmmememffjmjjhheffmhlifmllgiiiiiijjjigkijjffiijfjiiiiiiiiiggfhihggigfhfhffkfeejkhhhggeeiiiiggggiiiiiiiihekejjfffeeiikkeeeekhjhjjjjieieieiigihjjkjnnnnjkkjjjjkkkkjjjjggjgjjiiiiiikkkkffhjfefdhdfdhdgdgdgdidjdhdgdidgdhdhdffefffeffeggeeeefeefejfgffeeeeffegghffffeeifffefjfjggfefjjhegegegifggfggffefgfeffefeeffeeghfffegfffgefhhhfe@ q@ףp= ?eggffe8@ef}iiidkx}diiiigg#ehghe8@FN17 efeiAd 6 j@A08 a olihgiffgdedeNyakyusafej(@8@dvg{fgfefgffeeffefffeeefeefeffyhddujehdkdhldledeiqddeheiehddddddddddddddddddddddddddddddddddhhdddddddgdeegdgdddedddddddddffeffefgggfguffehhfffgeeeeeeheeeeimiegglgefeeeeeeeeegeeeggeeegegggghegvegiheglefffeeddeegeedlggffflhgeefhhfjheghegggegegihegFN17 8 Nyakyusa (Ngondededdded) dddedddddddfdgdddfddfdedddfeeeedeeddddeeedeedededeeededeeeefefggfgfehd{eeeeeeeeefgfleimps{ks|ideideideideffffeeex9.30S 34.70E @Z@hlh +96@P@0c@fffffU@txzjxprwxxpddNyakyusagdddddeeeeefffg𑨃OKhjhhΫʝ?5sm?^e?x?^'6?v?. 70{׿d<ɓl׿?H=.P?hfegmHadza ףp= A@ffefeehgijeefeeeeeeiiigfffgfeigeeeefghfgfghehfhfehefgeileihffeeeghhgeeeeeeeeeedihdfedeeddddddcddieccdhdidifddddcdefdeeeddedgdgdi(@eeeeeeeeeeneeeekegjegkk{}@ztok@i@diedeemjhdddemklfiihfnhgmemememeeeegeeideeeejmmmmjmmmmmjemmmmmmmememeehmejfffleigigijijhhhhjflhffiiffgffgdidiffffhggghhfhfhffffiijihhggggegggkgiimiiiiiiieeeeiiiikkkkmmmmjjjjggggfifiiiiiggggkkkkjjggggjkjkiiiimimigjgjiiiifghklffhhffffffhhfffffffffffffffffffffffiffffffggffehgeeggfhgggfffefeifffegffhhgggffeeeeefheefeeeeeeeeeeeffffgefheeeeeeefeeeeggfgfihefgfffggiiiehhjjjggeeehfpdd,@eeeeddd}dedllmmeelףp= A@kegd(@Aa 9 @efeiefA02 b fffheeddddejpHadza eeede(@(@inffclddpldldldlldgfmehhgehilifgeheiekhgffggffffeegkejglfiejieljjjddddfddddfdeedddddddddddddddddddddddddddededdddddddeddddfdeeggggftffgeeeelhpejejeeeeellleeeeegeeeefegeieeegfeeegeggg 9 Hadza eeeeeeeeeefdmjorznrxgddhddjdejdeffff3.90S 35.60E eeex@fffffnU@4@33333sL@hnino`^@fffff&P@tztxrkknlddgdHadza ddddffeeefffwS)|>dhfH=.P?egnI#7?;? f?^xr?Luguru eETL7A`B@hgjiggffgffeeeffelffgkhhgefifgeegifefgjfhkkegfeegihghgligfeheeeeeeeeeedccdceedefiggeddiedidideeiedddiciccieeegefdfei@hghefiffkfgrjj~|X@wnfhlr@fdehhdeeekefffkiiegiefmemhmmmgghkjgjjgefhiegejgemjggmmmhemfmgffgfieejifgllifllgigighhhhggggffffjiiiiiggggffffeeeeggggggggeeeeiiiijjjjhhhhggggeeehhhhiiiiijijjjfffghhfhhhhhgighhjjiiggiiiijhffggffeeeffggeeeeeeeigiiddx@eeeegfiiiiijddiillgggdeETL7A`B@ed@Ad14 @A08 d efeilnggfiffdedLuguru jdhggfgfffghfffefeefxhddvldhdjdhldkhhdeeirdsdejdhddeddddedddddddddddhdddddddddddddgddddddddhdggggdddddddfiiiiiieegggferffhdgggeggegkjjjjeeleleellleleffhkliifeeffeeegeggg 10 Luguru eeeeeeeeefgfngkou|korxhedhediedjedffffee6.80S 37.00E ex @!Y@zG!6@fffff&Q@`c@U@slgttplddgdddLuguru ddeefffhd5;?<q 0x-?/?dhgeH=.P?goKikuyu MbXfefheL7A`B@jihkegfeeefemfggffhhgefhghghheehhegggefhghfheggghfjegjjelggggihegjghfeeeeeeeeeeeeddddedeedegghiefiieegdhgieieddeddegegieeeechdgdidgeiif@hefiffehjggghhfiefffg@ipuvsn@nkekedg@ehhdddgkemiikiilenhjmhmemmmlmhmiijkhgegjgjiekfkeemejmggmmgmmmemeimmmmfmemeefhkkhhifkmfffhlekjififffliggjjiillhhlliiiiiilliiiigiikjfhhggggfheeeeiiiiiiiiffffiiiiiiiiiiiiiiiiffffeeehhihggfkhifigieihhhhkkkkmmmmmmmmggjjjjjjmmmmggjjggjmhhhhkkiikkkkkjkjffijfkhhgffgghhhhhhggiiiihjiiggiiiiggggjjghegfeeeiffffegehgeffgfffgfeeegfihgfffffffeiefefgegghgggffhggefhgffffffkffffeifefhgeffffeefeeeffeeeeefiieehhfeefegffeeeffgfggfffegffeggegihgggejgggffiggeeefjegffggfhgfgfgeeegfeeffffhgffffffggeegfhef@ipev/?@eee}didikdiiffggeheheMbXL7A`B@ef@FL10 Ad 3 A09 b eijoihfiffdddKikuyu gee(@<@jdiugffeegfeffffefefeefffeffefclddvkdhdkdhkdlfjkkkkhgjjefededddgefdddddeddddddddeddeddedddddeddddedddddddddddee@eddddeddedeof@ixfffdfhlkeireedejdfhddeddddeehdddddddddddddddddddddddfdddfdfddkefggegeddheggggggwfghhhgfgeehhhgggghgggggggggggggggeeeeeeeeeeeeeefffffffffffffffffffffeeeeeeefdedddddiffdddeehhhgggghgggggggggggggggeeeeeeeeeeeeeefffffffffffffffffffffeeeeeeegdedddddiffdddeiefdeedggffeeedffeeffdddegffdeedeeffeefeeeffeefdddddddfggeddddddddddddiiffiffefeihgfihgfhifeiigflekgeggeeeponhklhkkkehhlllklllleeegfllleeeeeieeeeeeegggggggvfggefhedgfeeddehheedmgegggmggefhefjhfghghigfgffjffiggfegggFL1O 11 dddddKikuyu eddedfdfeffdddddgddggfddfdddeeededeeeeddeefegedeeddedeeeeeeeegefiiggeegeeiefefeeefgfogktzeiwgddiddiddjdeffffeee0.50S 37.45E ܝ@xuf33333Z@v1@Q@̜b@S@lj}qruv~|x~xxKikuyu ddgdddddeffeefffgfge fVtٿjs-ѿii;@?pe4#?hAt?B<g<4ſ<ɓ F?&oelhH=.P?u.Dtܿh( f¦gpXGanda Zd;O?@@@fehgjghggfhgfjefhfgfefefgfgefekhhgffhhfeiigegfighefhmfgjegjfelgiggijfigfhfjgheijelgeilhgjeiideeedeiiiieeeideiieieieddeicieeeeeeeecdddieefiifheL@hiihefhggfffkeefgqD@xywtĒ@hkdejdehkdeeekemiikiimfkehmhmemmmkmhmgihkkfhfjidfekfkeemeeeegmgggmmeeeimmmmhmemhfgmkkffgffgleffjjjjjiiliffijfgjlffjjllllfiiihhhhjghhiifheijjkkikikgigegejgjgikikiiiiiiiiigkkhiiiffeefhfgfeiiififififgghhnnnnkkkkjjjjggjjkkkkhhggjjiiiiihgehhhhiiiiffiiifhfhjhiefdhdfdgdfdgdgdidjdfdgdhdfdgdgdffefeeeefgigeeeegefeemfeffefefgeggefffffjfffffjfffgfffehegeegeggfefefgeeefeeehghgfeegeeeeheehheegegegeehhhfekܝ@h@9v?eeeeffnnniikdddȜiiliffZd;O?fdhhe@@@L@FK 7 efeiAd 7 s@A10 a mkiihfiffgdedgGanda effj8@L@djggffeegffeeeefeeeffeeeffesfddujdhdkdhldgemjgfflhkjekhgfgehjhgggjhgfhkgffghieeghiijmjhjjjilglglijjljdeidedehdjdjffhdeedddhddddhddgedddddefedhdddddhdeddddddddgdehgfegggggfveffhhgvsuekeelkkponlihelmgelgkleikglliffgikeeeegeeeffeeggegggghegvfifleflfdgfghdeghjjedngggeephffiefjfgggffkhhffehggFK07 12 Ganda fdddddgdeddddddedfefdeddgfgdeddddeeeeedeeeeddeedeeeeeeedeeefeddeeegehhgegffgeiiffffeeefgfepfm@}oideideidejdeffffeeex0.00N 32.40E @q= ףHb@jig= ףp=(@33333S]@fffffg@yR@wtpj{swtutddGanda gdddddeffeefffeeiݰ35?ijij;@?;y{{?ͤ?~W-?Z8 N?(mD?l-?d<ɓEL.IO?H=.P?ehhgqMbuti ?h|?U<@eheefefhhhhjeefeeeeeeieehggffhgjeggfghgeeifegighhhmgheheehffgegfgiifegeegfhgeeeeeeeeeedhghfechfddddddfddieiddhdieicddddeiicddecddeddgchdix@eeeeeeeeeeneeeeffkehiefeg}}{{؍@xtqmj4@@o@efldeeigkdddieffkiikefghmemememimhmleeegfeefiiheeegjmmmmmjmmmmmmjfmmmmmmmememeemmekjffflghhjjffjjffffjjlljjjjggiiffffhhhhffffffffnnliiiiggggiiiieeeeggggggggjjkkjjmmgggghhhhkkkkfhfhfhfhiiiikkkkggggggggiiiikkkkfhfhfhfhggggnnnniiiijjjjmmmmjjjjggggjjjjeejjffkkiimmjjkkkkiikkffffefdhdfdhdhdfdgdgdjdidgdidfdidhdfffefeeefeeefeeefgjffeghggfffeeefffggfeegfgfgeffffgffgegfegfghgffggefffeeefehfefffffjffeeegeeefeeeeeeeeeeeeeeffeigeeheeeeeffeeeeeeggggggegegeeefgiiheggjjigggffghhhheggeghkhgghhgigeghffeghheggeehhhhgegfgegeeeeeeej@q@/$?eeefeeeeggddiiellllffk?h|?U<@legex@FO 4 Aa 4 @i@eeegefA11 a eggfheededdejpMbuti fefdedx@@dfddditggggggfghffffffffclddwkdhdldhldlklllogdheeeededddfeeddddddddddddddeddeddeddddddddddedddddddddddeedddd@dddeddeqdddee@@y@ifdehfeddddhddddfdfheddddddddgdddddddddddddddddddddddddddddhddddiegkjeegggggufeeeeeeddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddgjhhhfjhhhhkeieiedddkkkkeggonelkleimeeeeeleeeeeefgheeegegeegeggghewijieeedeedgddiedgegeedeeeeddddddddeegeedfdehgggfeeeeeefededededFO04 13 Mbuti (Pygmies) eddddgdeedfdddddefgeeddiffhdddddeddddeededdeeededeededeeddddedeeeffdfgegeeeeueeeeeeeeefgfneqios|gqfddgddhdehdeffff2.10N 28.00E eeexP@)\$h@X9v(@a@hfklnyLm@fffff&W@xtl|tltllddgdMbuti dddddefeeefffj,f@X˜@ejegi7UH",(V ѿ;@?ge"HVc#wS!"@?8P?ghhFR26?(Q? Iſegr۱aK!@Nkundo Meeongo 还n*3@hfjhgeffgffjeehgieeeejeehheffhgighgeeheghfegffggjjhggfjfggkelpggfihhgikghiefeeeeeeeeeeghiefeefiiiiiddieicdiegeiceeieheciecdeeigheeei(@hfheifgghfgefgfffhefefegdd}| w@@w~mpdf`x@mdeiheefdjemlliiileiejfhmfmmmlmhmjgijhgffhfegejfeemjeegmmmmmjefmimmmmemgmffefjjhhjifglleggjjiihghghhhhghijgigjffgggfgfffffhkggggggggfffheeekhhhhggggiiiiggggiiiiggggeeeeffffigihkkkkeieigggiiiiikkkkiiiiggjjjjjjggjjjjjjgkjkhhhggggkkjhjjiijjjjfhjlkjlfhggfjiddddddddddddddddddddddddddddddddeffeeeefgfefeefejieeeefeeeheffefffeeeheeeeegfffgfffegfgggheghgweeH@@~@+?efeeeeiiiiij}dlljlgggdg还n*3@he(@FO32 Ae 4 A12 a eeeglnihfgfeNkundo Mongo hdkvgffffeeffffffhfffeffffvfddxldhdldhldijlfi|dedeedhdhgdeeddddeehddddgdddddeddddddddddhddedddegddieffgggfgvpodgglfpeeeeeelleeellleeeeehgeegfeegeggggfgfdeFO32 14 Nkundo (Mongo) dddfdddddedddddfddfddhfedededddeededededddeeddeedeeedeeddddededfeegfeeeffdteeeeeeeeefgfrdfhkqw}filpxfddgdegdegdeffffee1.90S 18.10E ex @Gzf@jt)@̼a@ik@YS@hfljxvnrtvunnlddgdddNkundo Mongo ddeefffg&"ҿhh<F?&MX.V?n?geph"@Q? IſgsBanen ^I @fgg%@jhgeffghffeefhefffejgeffgjfghfggfeggggkmjehhkelgggfiheggkhffefeifegehfdicddeeeedeiigiffdididieieiegeeeegciecceeidehdfeihg<@hegggffjeog @hhyzws@flpgfldv@eieeedekieiikiilenhjmgmemmmgiifefiegejeemjggmmmehgimmmememheeekkeejfflkeffjjlllliiiiiiiiiilmffjjlllliiiieeggfhggggggggegjggjgiieiieigggefffiiiigggeeeeefefggggffffehehggggffffffllggeiggggggiijjmmjjmmjjmmjjjjkjmkjfjfiiiiihiheeihddddddddddddddddddddddddddddddddeeffeeelgfffegeghefffffeeeegfefffffefgffgeghgfggfeeeeefegefggfffffkeeegeeeefeeeeeeeeeeeeeehgffeeegffffjffgggfegggeeeggeiihhhijjgfgfhhhix@fe?eeedddddjhehfffgdehd^I @%@ee8@Ae51 @A12 b eglnihfiffBanen jdlxffffeeeeeffeffhffeffeefyeddwldhdkdhldeeljgghgfieegfkfhiefjieefkhjhehifjmfjejhghyeedehdhdddddddddgddddddddddddddddddddddddddddddddddjegfgggggxeeefddddddmlleeleeddR@h 15 Banen eeeeeeeeefgfskunvgedgedgedgedffffeee4.40N 10.00E @xkgQ{p@fffff&+@@i@̴t@)`@jftxxtxlBanen ddfdddddeefff֍}3ݿg@?(Q?eph Iſ3Vuh( f¦gtmXTiv @deigjhgeffggfieeheeekfegjeehheffhhjfhhffhggeghgehfihhghgjgghfjeiijelpggghhgijghiheefeeeeeeeedhhhedfeedgehihccdiecidhdiicgedeeeecdieceeccgeideeihhhe@ehgfegfjflemgi||wd@@o@mpigldelgefeeiimlliiikeiejmigemhmimhmlgiihhfejiheegejkeeljmfgmmmmmjefgmmmememhfmmekehffmhlgjijiffiiiiiiggljiiiiffllffllllllggjjlilgghhfhfheehhiiiiiiggkkkkffmmfhiihhiiiiggfhggfhiieejjggfhfhhheejjggeifhhhhhmmmmmmmmjjjjmmmmmmmmjjjjjjjjjjiiiijjjjkkkkgglkddddddddddddddddddddddddddddddddeffeeeefghgfffgegefeikefffeeeegefehffffeeiffffjfjhjgfffffjjffgejggiegfeggfheffegfeffffgffgfhfegegeffgeffefegdd@{eee|@eiiii}jdgg@mgdfje@FF57 effiAh 3 A13 a lnihfiffddddgTiv xeefjP@t@diffffgeeeeffgefeffeeeeffxfddwldhdkdhldlhiedededdddefegdddddddedddddddddeddedddddedddddeddddedddddeeed@eddeddedetdddhd@eddddefddefghiydedegdidhfeeddddddddhdddddgddddddedddddddddddddddddddddhdfheffgfggfufifhhhgffgeghggeifdddddddddedegefefeeffeefeffefffdefdfgeeefewddddedddddffhjddegjdddddedddedejdddffffdffddddddddddddddddddfihiiifffeefevuqeeeeoimplneeeeiieieeeeellllllffggheeegggfeegggggeewjfgjffffeeeefeiedegfeegeeddddddddefinfheggggffeefielfggggFF57 16 Tiv ddedddededddddddddffddddgefdddeddeeeeededededeedeeeeedeeededeeddedffehgfefegeziiffffeeefgfdtpfmygddhedhedhedffffeeex6.47N 7.55E @rhe@qflkt2@^@Yq@fffff6c@pzrxxxxxvddTiv gdddddeffeefffhgkgKB?(?hghΫʝ?yQcB'ЬJ`@.ÿY˿g߈ G?U?;\ZNuĿmThgeguffIbo @ET@dfigjhgkffefjefegfkfegfeffgfkffgehegifegihhgggkggjfjkmelmggegkfheehhfhefeeeeeeeedcddedddffhigfedheedhieideeecdcedieechgide<@eihihehigfggggjgijelgi m@}zsno<@`s@hgndejddddememlliiilenhfmjgemmmkmhmigijihffeeekejeemmjmegmmgmmmmmeimmmmememheefkkeegiffllgiijjjjjjjjjjffjgiijjffigfggifififffffffikhghhiigggggghfggjkiiiiggegggggffffhhhhggggeeeefhfheeeeiiiiiiiillllggggiiiijjjjnnnnkkkkjjjjkkkkjjjjkkkkiiiikkkkjjjjljijllllkjkjiimmlllffffffgdhffhffhhfiffkigfhghhffiiffigheeffelgfefeghhhfefgkfffeffeeeegfhgeefffffffghffhhffgfffffffkfehegeeeeeefeeeeeeeeeeiheeeffeeeehfeeffggfgeghhffgeefggeiihhghjjgjihhgefeifipL@v@ rh?egfffeefeiidi}jjdffggg@ET@dfhe<@FF26 Af10 @eeeglnA14 a eihfiffgdddg|Ibo eejdddeedejzffeegeeeffffeeehfffeeeefyffhxldhdldhldjhhllleeeddd<@dddedeejyd|defdjddddedddhdeddddddddddddddddddddeddddddddddddhdgeggegddgghhhhgegggggwfhdhgheegfhghfeggeddddddddggdeggeffffffffffffffffffffffffdffdeeeewddddedfehddefhghfeggeddddddddggdeggeffffffffffffffffffffffffdffdeeeervdddddfehhddgedeeffdddgeddeedddddddffghgfgeffeiifffefehhggiffeffeggffhggggffemgehhfggffeqpeffefinplgjgjmkmmikkeeemiklkkellleeeeeffggheeegggggeegggggefeFF26 17 lbo (Igbo) ddddefdeddgfdfefgefdeddihgefedddedededeeeeddeeedeeeedeeeeeeedddedgfghgeeeefezjjggffffefgfedujpknrwfedfedgedhedffff4.85N 7.02E eeexp@Rn@㥛 0@d@qju33333sr@_@z||qzpqrloddfdIbo dddddeefffi;@?h $8?Y˿2O h?߈ G?gep Iſhgv f¦YfeCFon ge@(\?igiihfehgfieffgelffgjeehhgefgkhhgffiggegihfgeiefefghegejhkimfjpgggfjgilkghijhgeijelgiilehgjkiddeedeegiiccdieecdiceeicheeeeceeiecceecicdfdegi@hiiehhihgehfghfflefghio~|؊@zmjpjgl@ldejedfefiefiikiilefgfmimemmmfmhmegikkghelhjfegejeeeljlggmgmmeehimmmmhiemheeekkhhfifmmlfjjjjjjggjjiikkijjlggjkjjjjffhijggggggggghhkhiijghiiggeiiikigfmfiiigiiigighghgggggeieiffffiiiihhhhggggggiihhkkeieieeeiggggmmmmkkkkllllkkkkkkkkmmmmkkkkjjiiiikkkkhhiihfffhefdhdfdfdfdhdgdididfdgdhdhdgdgdkfffefeffgigfeeegefefjefeefeffeggeffffffkfffifffefehhgffgegffefeegfeeehggggefheeeefefhheeegegegfehefiegH@ y@Q?,@gffeefegxdxixjdȊiiffgggdh@(\?hdn@Af 1 A14 b eifilnihfiffdedgFon jdhngeeeegfeeeeeeeeeeefeeeefqeefwldhdkdhldlljhfihffifihejihfhhieifjghhigieghigjiefeillljjj@dddddddddddddiqdrdeididjhffdddddddhedddhddghdhddeddddddeddededddddddddhdeggdgddddddddddddddgggggiiffggggfvfghhggfeegiieggdgggdgfffffffffffeeeeeeeeeefddddeddjefdddeeiieggggfffffffffeeeeeeeewddddeddjefdddffffdedddddddhifffeefefeddddddddddddiifemvguegeeiionlkhelleelllllleeefeelefggeeegggfeeggggvegglefkfefgfiighhfihggmgfgeflhffehgjfjmefghffeejgleefhe 18 Fon jegefefeefgfvhkouhlryhedhedhediedffffee7.10N 1.90E ex@GzZ@Q6@@O@fffffb@LV@sflgwp|v|}w|qddgdddFon ddfffeefffe"/eki3>~c?;@?jk}'*?|-?Cz ??2O h?COxeH?ELqޤ}f?gehh 8c?gwkAshanti eehejhhgffhffieefgflffgjegefhghfigefgfeggfeghghfihhfgejhhimegmffgfhfiimhhhehegjhggehhhgkcceeedeiiiiccdieccdhgiccieeccieddeecididceihg@hehhigfkeehq@i~{w$@wjefgldj@ejgdefdkemklifhiekegmhghmmmgghkegikkhgfjfdgegejfeejggmmeegmmmhmemffjmgghhfjfmllffiiggiiiilliijjfgijijggggggggeeeehhggffkkiihhiiggeehhkhiihifffggeghhhhffffffffggggffeeiiieeigggghhkkkkjjkkiiiijjiikkkkjjjjiiefdhdfdgdgdhdgdidfdfdgdgdfdhdfdffefefeffghgffeffehgffffjfffefheffkfffffhfeeeffifgeffffhffggfgfgggggfgefgiieeeefffeffhfgffffffkeffeegejggfefeefeefefeffeeefefhfffeehfffhhigggfghghegfffgfegihghghjgfghhhffffgigix@meFx?eeesisiijddffhgffkgdgmeei@FE12 Af 3 A15 a filnihfiffgdddAshanti geeP@d@fjdi~fegeegeeffeefeeefffeefffqeefwkdhdldhldhiijedgeefdegfhdfdddddddddededddeddeeedddeddddedeeddddddddee@edddddew@geeddddeedddddeyggiydedefehdjhfffdedddddfehddddddhdeddeeedddddddeefdddehdddhdddggggddddddddddgffhhhhhgeggggfvgfgfjeieeeeelellllelgllleeeeeeheeegfggfeegggefffvfhfegfgedeghjhedngeffgpgfhhwfehhhgeeegggfgfgggFE12 19 fddddAshanti (Twi) dededddffddedfdddddefdf @edddededddddddddeeeeededdeeddeeeddeeedeffhegdefdteeeeeeeeefgfdwhhp{inwgedhedhedhedffffeee6.72N 1.60W @xsea@/$"@`\@fffffd@K@kfrt~ztAshanti ddgdddddeffeefffiigi03 ?;@?d_e p!?aW峁?d+?(p2A8Կ=,o?d<ɓelh 8c?>,[G̰gxXL!Mende ET@dfihjiggffgffiihfhelffgjgefgighgfeeiiifeghghghhijggijekmgggghfhikihhfhhegjhfgehhihjfciheedeefihccdieicdieieieeeeeeieceeciggdceihfied@ghghegfleohns0x@~~{rpd@y@leggedejiedeekegkliiilegffmgmemmmhhkklgjlihffljiiegejeeeljlegmmmmmfeigmmmhmemhfefjjeefffhlifflleggffigfjjfiilggllllliiiiiiigghhggfhfiikgkiihhiiiggeiikkhiiiijikihkkkehheieiiiiikkkkeieiggfgjimmmmjjmmmmmmifiigigffffijijffljjjffifhhhhhhhhhgiijjiiihfifgjjffjjeefhjieqfeffgeggefffffkffffjfgggffhhffffifeffeegfgeegfggeeeeeeeffgheegefegegeeeefm|@p@ rh?veeed@efiiii}jd}iflgggET@Xgdfhed@FC 7 eefgAf 4 `j@A18 b lniihfiffgdedgMende eefjP@d@dhffeegfeeeefeeefffeeffefwefgwldhdkdhldjjjhjhitdedefdidihddedddhddhgddddddddddddddddhhdddehdddhddddgdfgggddddihhhjjhhffgggffuffhffggggggkjjjjleleelllleeellgllkeffggg,V@geefgegeegggheegFC07 20 Mende ddddddddddddedddddfddgfdffddddddeedddddddddddeeedeeeeeedddeddddeeeddehgdgdfedreeeeeeeeefhdxhkmptxikov|gedgedgedgedffffeeex7.53N 12.50W x@p= #w@skV-'@33333#r@$|@33333d@hjprxrsxdgMende feddddfffeefffgg]͟hi~r ?“?Ym?0G[?_?g߈ G?\?˃^ҿephfyfgWolof +@"~.ffihjigkffggfiigehfnfehkeehhgefgjfggegeggfeghfgfhfgjhgjjflmgfghieeikghhegfeioefgihklgjieeeedeffffieiieciiieieeeeeiieeecieedex@hihfifgihijfffsethdd|~xelh @@o@lmedfffddegjemkliiileiejmgmgmmmgghhlgjklgghliheekfjfeeejmeggggmmieeefmmmmihfmhfefhheegffkhlglhiiilliillffjlfillfillmmmmiilliiijlhiggigfhfieekekiiiehhkhffjfiiiiieihhhhggfgffefffefhhihfflfffefiieijejfgjleieieegffjimnmnjjjjjjjjmmmmmmmmmmmmmggkgfijiihhgikikmmmmgikmfegdhdhdhdhdjdididgdidgdhdidfdjdhffggeelgffffhffheeefeeffgffeeegeigegefgfeefeffeggffhfffggfeefggeeeefeeegegfhffffffkffgefeeffeeeffeffeigeeehffefehfffhhjefggghfeefeeefgegighhffegfhhifgefegff@?eeeeiiii}jxdd{ffffgeg+@"~.hgleyx@MS30 Cb 2 effilnA16 a ihfiffdddgWolof eejddP@p@dfeees{|ftffeeegeeeeffeeeheffeffffteffyldjdkdjldhhmjhefifkleeihiigflgkhihifgjlfffhiiihlghgeheeeeedddx@ddeisdedegdjdjfdeeddddfdddhddddddddedddddeddedddeddhefdddlegegggggwfifhhgfffhhffeeeegjeifeghihhmffeefeeeeehieeiffieeefeffdddfdddddddeeefeiiffifeieiiffeeeeeeeheeeeelgeeelllleggheegeeeeieeeffggggegggeeeevfkhiffgfggffeifgehhfjfggmfefffpggehjzfehgffgggjeeffgggdMS30 21 Wolof dddddfdddddddfeggffdgfdhgfdedddeeeededeededdeeeeeeeeeedeeeeddddedfeghhdeefgezeeeeeeeeefiddydinp@stuw|glotvwy~gedgediedjedffff13.53N 14.77W eeex|@q= ףY@Pn5@̌M@uflfn)`@̌Q@pi~~v{{~yeeffWolof dddddfffffffei;@?jLh?~ *J?K,0?YX8 <ɓge&omThez?A b>7pyޭٿBambara ]e)@hejiikffggfihehflffghhgefghghfeeegifehggfeejhihjeipggghkfhikghifefeijejhfdicdeeedeeffgeiiieeiiieieieieeeefceeieedeccigdiefgi@ihigggghfgeefkfqelhv}t@t@dlejh`s@edekefdefieflliiilenhfmhgemmmgghkgijkkhfejiekfkeeeejefgmggmmiefgfmmmmhmfmhfefjjhhjfmkmffmhlfigljggjjiiiigegeffiiggijiiiiiiiiiiiiffhjigiiiieifhffffekekggggggggggggkkkkiiiiiiiifekkjkkffeeiffkkjjkkeieieigghhmmmmjjjjkkkkjjjjkkkkkkjjjjiiiijjjjkjkjiikkjffffhhhhhhggiifhjjffiiffffjjhfggeffeeeefgigfeeeejfeeeffffffffkfffeegeifjhefefjjgffefeefeefefggggeeffefhheeffegfgeghghegfee@x@{Gzt?feeeeee}iiiikxddȋllllff]edf)@hep@FA 8 Ag 1 A18 a effiolihfiffBambara jdhegfffeefeeeefeeeeffeeffffoehgwldhdkdhldjhheh@eeededddddededeejqdedefehdddddddddddddddddfddddddddddddddddddddddddddhdgeggggddddddffgggggwfghhfgggfikkkhffffffffeeeeefffffffffffeeeeeegddddddfdddfgggfikkkhffffffffeeeeefffffffffffeeeeeefddddddfxddffeedfffdddddhkeieijhhheififmmiiffenjjjhllkllhhjlifhllllllhlllgglkgeffgggeeeffefegegggfvehjlefjfefffgheffejhgelgegggpgfegiefeffehigfeeefhfeggefdfFA08 22 Bambara ddddddeddedddfeffddddffdefdedddddeedeeddddeeeeeddddedeeeeeddeeefegehegfeddveeeeeeeeefhd@dzeehkv}eimt|fddfddfddgddffffee12.90N 7.30W ex؝@Q^W@o-@33333P@^@M@slqzvxlruxxxrdgfeddBambara ddeefffeц4ekih3>~c?;@?'][ɿX>}e߈ G?"gehmTf{TallensiRQ%@feeig/$jigeffgffieefhekgegjeehgeffhgkgggieggfeiigehfiggghhghehgjeijjelmgggihfhlkghhfefeijeggehlhjiedefeedeegfeeeieiicieieiedeiccfddieddeecdcddfeiih8@hegiffeheffegggggekheddfkefkliiilemfjmhmfmmmlmhmlijiiheeijdeekfkfemejmfgmmmmmjefffmmmmfmemffhmjjhhhffmhlffmkmgggggggggffffigljffjjffjjhhjjiillggiiffggljjggggggeiffffiiiiiiiiggggiiffgggghhhhffffefefggggjjjjffffgieieieieeggnnnnkkkkhhjjiikkhhhhjjhhhhiiiimmllllllmhmhggjjlllhjklffffhjjkddddddddddddddddddddddddddddddddeeffeeefgigfeeeeehfeeefifeffgfggeffeefffefffeeegfigffefffeeefgfegffggegggeegfljekeeeeeeegehfeeefeeefeeeeeeeeeefeeeeegffeegggggegegeeefgehiihhfejjiihhfegeefffgeffgfeffffgegeegfefffegghgggffgegfggehfft@u@fB`"?feefiiii}kwd}dxllljeeedeheRQ%@/$ef8@FE11 Ag 4 A19 b fiolihfiffgdddTallensigee(@8@fjdxy}gqfggfffefffggfgffffffffeefygddxldidkdildlkjjkkkee8@dddddeddddehqdsdehejdfhdddddddheddddddedhehddeddddddeddehhddddhddhddeggegdddddddddddfgeeijhgkfegggggggyfghghgfgeegigeegggddegeegfffffffffffeeeeeffffffffffeeeeegjdddefedffgggeegggddgddgeegiffffefffeeeeeeeffffffffffeeeeeoddddefedffffdggdggieeffdddeeeddeddeffdfdddddggghffeiifffffefeiiffifeiifffefeiifffeeeeeeeheeeeeeeeegeeeghgeeefggeeeffegegggggeewofgejegefdeeeeddeggeededeeddddddddefimfggghfhggeeggffgefgFE11 23 dddddTallensidfddddddffdffffdefdgede @eddefdeddeddedddeedegddddedddddededddeddggfdeegdreeeeeeeeefge{kr|jpzeddfddhddhddffffeee10.50N 0.40W @xrfףp= \@MbXy+@V@b@kkspplzttx~tnTallensiddgdddddffeeefffgg3Wf?i{?*?h?ь4o#\OŠ][7߿^e.u?gV {MP?_j*?eph0Ϣ7 !?mTւ bN}??A b>7pg|yޭٿSonghai h|?0@y&1ffhgiiikffggfjfhfeekegfggggieehgghhhgeghedefgfehgiggghjjgfgfjhihiegfggegkfhikgfeeeeeeeeeeeekgieeeeeeefefcfcieccihehiieegcheieiececcgefhiihhfP@eggihfefhueghdd@o@ydq@keniedffgddfgiemffkiilemfgmgmemmmemhmgijkkghhghekfkeeejjeggggggmmeefmggigfmhfefhheeggfekjfmkmeiiiiijffjigiiiiiiiiiiggijihgggiiggeihhkkeejjhhggeiiiiikkkkiiiigggghhkkiijjeieieieeeeggggkhfhiiliieieieieeiejjhhkhjjjjkkkkkkkkjjjjffiiffflfhhhhhfffhhggfhfghffffifhfggiiffiffffffegijefsefeeffefegfgjjgfefggin@`s@Mb?kefeP@eeffiiiikn}ddwlfllggh|?0@ehhhdy&1P@ekgfCb 3 A19 a olfgfieeddddgSonghai efigddwwfgfeegeffeehffffffefcihguldhdidhfdhifehiggleghigkiiifeieghghhffhhfghheijhfhjfheejjjjjjjjljdiqdedegdieihdeeddddfehddddddddddddedddddddddedddfdddddhdedgddddddddddddddffiiiffifegfgggufgjeigegkffoneleligmelgeelifkllghegfilekddg 24 Songhai egkd|dfgjmsvdikmuw|gddgddhddhddffffeeex16.72N 3.00W ,@R6@ojjkףp= ?@333333$@333333E@fffff&@@mxosqxxueeSonghai efddddffffeij^?ӏ?.1#!??L;ֿ=,o?/?gMHT?ephe}seePastoral Fulani @dfiegikkeghfjfefeefffejeehgeefhgkfggehggegggehfigggghhhghgegggrejggggehfhikihfgefeioefgegfjicdddddddddddcgiiediidificiddgdggcgdedddcgdidi|@eeffefefgetegefkfpeogir~y@ypdle@@o@kiedffhdddmeemiikfhlenhemhmemmmeehffjefgfhjifekfhelmmmmfmmmmememeeekejfffleggjigfjijiiiliffiiifljifljggjiggjjddhijggggggfhhgkgegmgiiigggiiiiggggiiiigggghhhhffffffffeeeeeeeiiiiiffffgieigieiggggmmmmkkkkkkkkiikkjjkkgglijhiillllhimkmkffjijllhjfflhhhjjjfeidgdfdhdhdfdfdfdfdgdgdgdfdfdjdfeggeeeiffeffhfhfffffffghfeeeegfhfgfffffeffffgeghffggffefeggfxffeffeffeggeffffeeiffeegffffeeeeeeffeeeeeeeeeeffffefefeeeffjgegfhfgfgeeeghieiiigjfjjjhhhffeefegifik@~jt?eeeeidii}iȱllmmeesh@dfhd|@Cb24 @eifijoA17 a ihfiffgdddgPastoral Fulani eefjedx@@deede}igfefeefffhffeeefeftgfguldhdidhidlllfhjeeddddx@edddddddeejsdedeedgehdedhdddhddddddddddhddddeddeddddddddddedhddleddgedddddegiiiieeggggesefifhhhgfgddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddiiiifeeffdddefefdeedggffeefeeedeeeeffddddddgkeeddddddddddddhiffjffefeieiifffelkekkekjejeijlflelllleeeehggeeeeeefgeeeefeeeeegggvgkleflffdgehedfegeiegleeggpfffhgfhfgifeheeeflegfe 25 Wodaabe Fulani efid}eefhkt|egimt{~gddgddhddhddffff13.78N 8.98E eeexX@K7K@Hz7@9@kfkjtrRT@ףp= 7K@uto{ryyuvmeeefPastoral Fulani dddddffffehΫʝ?e䉁X>}e/?S?pDOgep^Uɱ׿ 8c?he~ f¦XHausa gege%@@igjighffgefjfffhfmiggjhhhhgefhggjhhgegiegggfheiffggjmhehfjhjijflmggegjfhkfhhighhijeghiilgfehjkideeedeeeefgeiiecieiieigeedeeeegeeegeedeii@iihfghiihghfoekgi}{ @D@rdleih r@edffjeddgjekkliiilenhfmgmemmmeehhgjjklghhihfekfkeegeeegmgmmeeffmmmihfmgfefhheegffmhlehhhhiiiiggggggllffiiffiiffiiffiiffhhffghjkghhhhggfhehhhjjjggggieiefefggiiiiiiefkkgjjffieiffffkklleieieiggeeiikkkkkkkkjjjjjjjjjjjjjjjjkkiijjjjiiiiggiikflkflhglhddddddddddddddddddddddddddddddddeffeeeefeggffegfeeefefehffffffffkffeeffjghgegfjegegeegiegfeffeeehggggeefeeeeffheeffegegeghfhefzjef@pq@MbX9?eeeeegfiiii}kiddrhheeeeehh%@@hf@MS12 Cb26 @A20 a eifioleihfiffddddgefHausa fjdP@t@rreeegeegeeefeeeheeeeffeftggfwldhdkdhldlfkhiigiiffddeffedeefiehdddddddedddddddedddeedededdedeededdeddddd@eedddede~f@ghdeddddejjedeeddkdeirdsdehdiefdefdeddgehdhdddddddddddddddddddddddddfddddjedgddeedeedddddgeeiiieeigifffgggfgvefghhggfetssgggfjlkponeieeeeeeelellleeeejhgefhggeefggfeeggggehegwdejjgeflffgfhhfhghjgmgggfephhi|edldgkjfhghdddMS12 26 Hausa dddgfddddedddedffddddhfededdedeeeddeeedeeeeededeedeedddeeedeeeefdffgfgefgg{ehqd@@d~iq|jowxfddgddgddgddffffee10.60N 7.45E ex@Q`@(\-@Y@e@fffffQ@xlljktxpzrrrrpoeeefddHausa ddffffehiw?;@?kk>S8?8 ?(mD?6/[9/?B_/ 6NN8?gephΆ"@? 8c?eMassa (Masa) %@fh/@iiikgfggfeeeeeelffgmgjeggghdeeefgghjehijelmgggihfhghhheegeeeeeeeedceefeeeffggggegieicidicieeefeeeiedeciceeeiig؝@heehfeoergy@nn~w@dlekhld@o@emmdegeiemkliiilenhjmhgemmmlmhmljjihgefdiekfkeejegmgehehmmmememkkhhfffhlgiiiiiiiiiiiijjjjjjfffhjggggfhfhhhhheeeeiiiiggggffffkkkkiiiiiiiieeeeggggeeeegggggggglmlmfehdhdgdgdhdhdgdkdgdidfdhdfdfdddheffeeefegffeeffefefefffeffeeeegegfhgfgfeeefeeefegffffgfeefefeeeeeeeeehgeffeeeffeeefffeeefgfefeehffffffgffggfffegeeefgfffhhhffejge@feeee?eee}}iiikwddllllffejehd%@/@ei؝@Ai 9 0@A21 d fiolihfiffdddMassa (Mgasa) jdhvshferjdhdhdhldgejigihglhgfjefejhffhjjhisdedeidiehdgggggggyfifhhhgffvueeefiioneleeeeeeellleeeehfeeeeddieeeffgggegggg 27 Massa ehqdlnwflpqv}fddgddgddhddffffeee10.20N 15.30E D@xsRA@/$F)@Q+;@p= ףF@\(2@nxxn|pnMassa (Masa) ddfdddddeefff<geh 8c?? f¦gXAzande ET@@<@eefiigeffhhgjeefgekfegjeegfffkfhgeeeegjfeggefffeghegfjeggjelgggggjeggkhfhhheifejghhlfhehgdeegeedeiihhcddieeidichcieddefeegedieeeeecdgecdffihfheĝ@hfhgfgeeeifkhfgeffiegk{X@}~zvm@@j@lehekdemgefedjefiikiikemfgmhmemmmkmhmegjigggglihfeeejeeemjeegmmmmmieimimmmmhmemffefjjhhhffmhleiijjeeeeggjliillfgjffgfggeiggjgiijiiieieeeeffeekkiieiiieekekfffeeeffkkfieieigghhjjjjmmmmjjjjkkmmjfifiiiffjjffijijffijjjjfeddhdhdgdhdidfdjdfdgdididjdfdgdeffeeeefeggfeeefeefggkffefefffefghffeeeegfffffjgjgjgggfffiigffeggegfgeeehggggeeeeeeeefehfeeffefefeghhhgfe@Mb?eeeeeii}}dhdkkmmeeET@gdghe@<@ĝ@FO 7 effiAi 3 A21 a lneihfiffgdedgAzande fjx@@diueefeegffeeeeefeeeeeeeeeeefwfddtkdfdkdfldiqdedegeidihffddeddddddddddddddddddddddddhddeddddddddddddleehegfgggggxgfifhhgffvuueeefjmlponigeejlkheffkfekllehlehllleeeffgggX@eeeggggegegggehegwifigfefleedefefhgehejhemgfgegpgfeeghheddegejgehfgegFO07 28 Azande fdddddeddddfeedeeeffdfddigfefedddedddddddddddeeedgddedddddededdeeeddehgegddedqeeeeeeeeefgedhkr~fmvfddgddhddiddffffeeex4.50N 28.40E @Gza@qfhC2@33333T@ffffff@YX@uzhx~oddAzande gdddddfffeefffeeh:-w?fjhi;y{{?Q"y~?d? {?Y+?znM?vg߈ G?EL|)?mTelhgfgFur (Darfur) +@9@fehgiiikgfhgfjffffelffgfhhgefihfhheggfegfeeemfejhghjgloeeehhfeikgijeheifehghhihiidcegeedeegggcgiieeiiiiicicfgefeeccciccceeigecdg`@iiififfgighffghgne{gdq@@ydkp@g@jhpdffkddegjemllfiidhnhhmemgmmmkmhmlijkghhifekfkgejggeighmmmhmfmgfeekkggjffkhlffehlfjjjjijiihfkiigjiggjjggjjijjlgigiefefgflggiiggfhgeihgkjighigggiiiiffffiiiiiiiifekeglffigeeekejhiigiiiiggffggeiggeiggjimmmmkkkkjjjjkkkkkkkkggjjiiiihhhhhhhhijijggiifglffggffffgghhiiffggffgghhffffffffefffeffggeeeegggeeeiffegfggghfffffffffffeeegfgfggffffefiffefgfgggfffgfeeegokxeffeeeffeefffeiefefhfffeehfffhhjeefefffeegfffgfffgghhggffggehfffefgt@?eeeexxxiikdȍllmmeee+@9@hhed`@Cb17 X@ekgjolA23 a ggfiffgFur (Darfur) jddeedeeiqgfffegeeffeefegeeffffeffefteefwldjdidifdisdedeidhdfehddedddddddddddddhddheddddddddddddddddddfddkeeeefggfqfghhgftsgkgenmlllhgggfhhhhelllllllgfeiieefegieeeeeeeeeeefgveggleflfedgfhhdfggfjhiogfgegpgfggmgfhifgeegiigfggg 29 Fur eeeeeeeeegmdddfgimqwxdehknsv}gddgddhddhddffff13.62N 25.33E eeex@QK?@VMD@$@slfoK@33333sF@|onvwvv}tjeeefFur (Darfur) ddddeffffehe=?iaFf?(mD?+xͿŌrdhejhn MHT?ee r?ւ?A b>7pyޭٿOtoro Nudfba "~&@n>@hhjihgegfeeefeelffgighggjfihjejgggeffeeeehfhgegeeeeeeeeegideedeedfggggheeieciehieiecedidgcciieceegiidefi(@ihheegefieeefkifoegl}}p@8@sdkejhldemddfdfjemiikiilemffmhgemmmkmhmlijjgfdfekfkemmjmmmmmiemfhmmmmfmemffmmkkeejfffhlfijijfliifmimhffmiffmillllggiiligfggggeieekkjjiieiffggiigghejeijegegeeeeifjkeieieekekejkiieeeehhmmmmmjkknkejgffffgggghhhhjjjjgggihhlffgghgffhfhhhhfffiffgghhffhhffggeeeeeeehefgeffeeffeeggffffhgefegffifggggeghgeeefgeeffgfgggeeffgeggfefheff|l@@@Mbp?eeee}didiksdhfkiggedf"~&@n>@hd(@Ai10 8@A23 b eifiolihfiffgdedgfeOtoro Nuba fjdhdeffefgeeeffeeeeffffeeefftgddtidjdidiidglmjeehiegkegjgheeifgifhifgfifmjffejigljhkkkhijhedefddddggedddddddededddddededdeeddddedddddddddddddddd(@eeedeedededded(@ddhdeddddvfffhfldehsdedehdhdfeehddedddhedddddddddddddddddddddddddhdddefhedhddgggegdddddddddgeehhffhhgfgfggfvfifhhggfefegggggggggddddddggggggggggfffffeeeeefffffffffffffffeeeeeegdeddeeeeddjddfegggggggggddddddggggggggggfffffeeeeefffffffffffffffeeeeeefjeddeeeeddiddegegdeedgeifeefeeedfeeffffdefefdeedgifeefeeedfeefffdddddffefgegeehkiffeihgeifeegfeihgefeegfehhgefeegfeheihgefeegfvqufiefjiponeeeeeeeieeeejhieeefegegfeefeggegegge 30 Otoro Nuba eeeeeeeeefjdjoruv|gjpy}eddeddfddgddffffee11.87N 31.05E ex@R1U@"~j2@J@\@fffffN@sgutlqyqvvteeefddOtoro Nuba ddeefffg]͟gfg홲п~Jɿ,Pl[@<󿒃!")|>;(fgeph 8c?eShilluk #@dehh?@jiikgfhhfiefheeelffgieeiifffhkghfeeghfegfggehghgjfiijejgggggjghimhffgheijejgeilghicdfeedeefffceeieiiidieicdgcgecdiecdeccdedieeeihh؝@heehgifieeeffhgemeg`x@x}v@dkejhjde@emjeeefiefiikiilenhfmhmemmmlmhmegjjigffidfekfjeemljeggmmmmmjeehmmmihemhfjmkkhhgfmhleiiljgliijiflifgijggjjiillggggffffgghhfhfhhhkkjjjjggeieieeiiihikfffkeieeeeikkffeeiiiijjjjeieieieieeeemmmmjjhhhhggjjggggjjjjjjjjjijihhkkhfeidgdfdgdfdgdidfdfdgdidfdididjdeefeeeeffhgfeeeffgfeeeehfgeeeggffffffefgfeeeegfieffffeffefffefefggegfgeeeekfkeeefeeefehfgfeeeffkfffehefeeeeeefeefeeeffeeeeefeeehfeeegffegfgfgfgghhffgffeggffghhggefggjeehhegfefffeefgggeeefeefgfefgfgffeeeeefeefhef0@ie&1?eeennniijsd}dugdfhe#@?@ei؝@FJ23 Ai 6 @k@A24 a filneihggfegdddShilluk g{fehdu{fofeffegefffefehfffefeefciddwldjdidigdkee؝@eddddededddisdedegdhdjdddddddhhddddddddddddddddddddddddddddddddddleggggegeeddddddddddeddddddddgeffggffggegegggefthfhdhghgfeeiegdddddddddfdddfdddddddddfdddeeffdddeeeeddedeeffeefeeefdddddddiieiieiiiepomggefjiinhlelghlleeeffellljeefflllleelhffeefeggegegggggegfgieghffdgfeiggeeejhiengegegphhfhhefehhhhffeeeeflhhhghggFJ23 31 ddeeeShilluk dfeddedfdfdedggdgddhhededfeeeeedeeeedddeeeedeeeeeedddededeeeefdehgfgffge{iiffffeeeglgdfkqx~fkreddfddfddhddffffeee9.80N 32.10E @xsfq= ףPR@(\1@33333H@E@njm|toxtv~plShilluk ddgdddddeefffgigi2t{ٿ |?hfh_x?ZܓZ?in k]?w?0G[?ԗ=$|lCgM ނV?w\bf Kq?F޸O>ۿ0+= ?eph 8c?3Vuh( f¦gXMao bX9"@L7A`UA@dfhgjigggfhgfeefehelffgiiigefgejhfhjfhfggfihehikggfhfeeeeeeeeeedhgddcfeedefggggecieiecheheidddidhedihecdeeegghdeeiheheL@ggfe}hleg~y@~vhd@l@leigkdemkeeeejimiikiilenhjmhmemmmkmhmgjkfffieekfjemmljemmmmmemememefjjhhfffglffkhljjjjghgjffffeeeehhhhggggeeeeiiiihhhhggggddddddddddddddddddddddddddddddddeeeeeeeeegeghi~dd@eeeeissiijq}dffgeebX9"@gdfhdL7A`UA@L@eifiAi47 @A23 c kihfgeegMao iniheegddwjdjdkdjldhrdedehdlefegfgffsddddddmlfeeeeddf 32 Mao egodijpwefkr~gddgddgddhddffffdeex8.20N 34.50E @Hz^@snzG-@fffffT@c@YS@}h|tddMao gdddddeeffff8vkυܿg 8c?ehgKaffa (Kafa) rh@@B@ffjihkegggiffefegfgejiigefggfhfeheefgfhfgkgjefijfhgggggeeefehfjghhijelgihhjgegdeedeedeeeifeegieeicieheieieeicieeiiefceecegegdeĝ@fiieiffhihleg~y@}vlled@n@igkdfedeedfjemhjkiilenhhmemmmkmhmkijigifegkfkeeeejgmggeefmgmhmfmhekkhhffffhlgffmlgfflljghffhgjhjjffhijjkkgjgiinffggggggeihfhfeeeehhhhgggghhkkkkiiiieeeeffffeeeeeeeeeefeleieieggihmmmmmmmmjjjjkkkknnnngfgfiiiiiiiieeglddddddddddddddddddddddddddddddddfffgfeeeeieegfefggfefefffffeeegeieegfffeeffeeegeffeefegghfekfgfeeeeeeeeehegfffeeihfgefffeeeffeeeeeehhfffeehfffhhieffgegggegeeffegihhggfjegjk(@@y&1|?eeeefxdixdk}nd{hhffffe rh@@B@dhhd@Ca30 @fifjppC01 c iihfiffgdedgKaffa (Kafa) fjfdddeee{gqwgddvhdjdldhldjlhjgefhifgigeeffeiegehfhggfhlfgghkheggididedehdjdgfflegegggggwfgghfpojejfpejellleeellllleeddg 33 Kaffa ehrdnvimuyiddiddiddjdeffff7.67N 36.83E eeex@Q*b@V-r#@^@mniPf@ M@xjklqpq~m{dgfeKaffa (Kafa) dddddffffe-I?'NF=gel|yP~?hfN)RǿRHcҿ f¦XMasai eede `B@ieekkeefjfeffeeeeejeeihgefigjhggehhffgfeggfheekghgheefhgiejgggggieejjhfheeeeeeeeeeeddcdeeddedddddddfiiediiheeeiiddedddeiiieccecidgeidiee@eghffffewgeeeefefgkuvl@(@ksnehnfdedfdedmdemiikiilemfgmhmemmmlmhmieeefgfjhiiekfheemljmgmmmmmemgmmmmeemfmeemmkkeejgfefgljnllinlllllfffflihlllhhiiiiljljfffflieggggggfheejjmkiiiiehhhhkkkkiiiiiiiieekekfffeeeeeiiiiieiekkeieieefgfgmmmmmmmmmmmmkkkkjjjjjjjjggggiglgiiiihhhhliliiiillllffffgffjdgdhdhdgdididhdfdgdhdidjdhdhdeffeeeefgigfeeefeeefffeffffeifgfffeifjggggggghffgefeefeeffgefegeegffefggfeffhegffe؝@؂@~jth?feeeedddi}idgfhdf `B@hf@FL13 Aj 2 A25 a fieijoihfiffgdddgeeMasai fjf(@<@irfffeegeffffeeeeehfffeffffclddvkdhdkdhkdjjogdedddefedddffedddddddddedddddededddeddeddddddeddddddddddd@eeddddddeddddf@ghneedddddeedhiddddgdggeeddddddddhddddddddddddddddddddddddddddddddddkedfggegeeeehheehjfeefggggetefghhhfgddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddlljjjjjjffdddfheieeefffffefffeeddffefdfdddddgeddddddddddddiifemiifffevqueeeepnllelilgellllllhhgeekffggieeeegeeggegggeeeededFL12 34 Masai dddfddddgeddffffffgddigfgeddddedeeedeeeeddedddeedeeddddddeeddeegddgefffefeueiefefeeeglgimwhpzhddhddjddleeffffee3.33S 36.62E ex@Gz^@SC0@T@b@fffffP@hfmfwml}|xlddgdddMasai ddeffeefffeݰ3eki3>~c?pe4#?efd>pT[ܿkυܿ!"߈ G? B gehh${Ja)}?gKonso @ffffB@jiikeggefefegmfggjefgkfgfefeiigefheffijhjjjihjggggfeejjgghefghnefehfkdidddedeedfffggcgcieicheieiifeedddcggieeeeecfgdeeiii<@ifeigfhhhigfffgflegy@~~vd@lleigkdn@feedddfljmjlfiimflefmhmemmmgmhmiijkjhefjlffkfkeefefmeggggmmmemehmmmefmfmeejmkkhhfffghlgjijfjfffjjjjjjjjhhkkiiiiiilffffgiijigghhggfhfekfekjhhhgeihhkffmiihhiikgggkggggeeeehhhhhhhhiiiieeeekkihjjjjjjjjjjjjkkkkjjjjiiiiffffhhhhgegejhkikhkddddddddddddddddddddddddddddddddegffeeeeifegefhhgfefeffeffhfeeegfighgeffeeegfeeegfehgffefefeffljffeeffefigeefffeeeffeefffegheeggfeeehfffhfgfgfgffefeeffhegihggfhjeghefieeeheifО@t@ftf~jtx?@feeffg}diddkdjjjjggehfhd@B@vfi8@Ca 1 C01 b fjppggfjffgdddKonso en|ee@@ifhhffeeefeeeegefffffeeeeefclddqhdfdkdfidlfhjhehqdedeidjdhfeedddedddhdedddddddddddddddddddddddddddddddddleeegfgeepfghhhgffdelehpeeeeeeeeegfeekeeeggeeefgeggeggg 35 Konso eeeeeeeeehsjot}~gpygdeidejdejdeffffdde5.28N 39.75E @xu{GR@~jA@333333=@fffffFa@hzoth||zxvlwKonso dhgdedddffffe@eĿ$0 ͿgNw?U?VɬP+|yelhP~?yw Z?,oƣ?>,[G̰fmL!Somali G@eeeehhgikjeggfifefheefeejeehhgefhggggeegefgfgfeefihgejggggihgejghffgefeeeeieeedidcdeddddddcggieccihdicieddidiiededeccgeidihefhhf@gggfhjhhfkilegik@|}xqdifpmedfefdddmeemkliiilenhjmigemmmlmhmeijeegghhghiejfheeeemmigggmmmmemgmgmmfmfmhfjmhheegfffkffmhlfkkiiggjgiiiijjffiiijiligghgggeiffkeeeiggiggeeeeeffffeejejfieiegghhkjihiiiijhjhffkkffffffffgfhhiifhjjffhggghhffffffeffeeeefgigfeeeeeeeeeeehffffeeffffjggfffiihfefeeegfkfhehhgheffegeeeeeeefegeheegfgegegefhhgef@ s@y&1|?xeefeee@eidiiiidȖeefffemhdgheG@@MO 4 wekffCa 2 C01 a joihfheegdddeSomali eefgx@@eiefffegeeeefeeeeffeeeeffwgddpkdfdgdfgdghjhheidfeedhefieilgfjfhiifhihggfhifijlfhjfhiellgjsdedeidhdihdddddddedddddddddddddddddddddeddddddddddddlegfjfeegggffsgfifhhggffuutfkfemklponkikemmekkelemkemkkelgfligeeeeifffffd@eeeefeeegegggeeffwgkifffleeegfeihggggeghfeegephhhefiofhehehfgefgggigfhfeggMO04 36 Somali ddfeddedfdeddfdedddfddddhegddeededdededdeddddeedeeedddedeeeedddeedeegfgdfeeedseeeeeeeeehsjeeeeefffhhddddefhjrgddiediediedffggeeex9.52N 45.57E @m4@iflfGzn<@(\B(@= ףp=?@\(3@rnsnnpr|dgSomali feddddeefffffefjeikq?f3 @ǒ?3>~c?hgbMera? ?C,E:;?n?Cc ?gϟ#S?b=R?s?elhffgAmhara )@B@gfigiiikffggfeffhhlffgiiigeffhfffieggfeggfeggifhffkghgggjfhijeingigjeeifkfiighiifeghiilijklcdceeedeeeeecfgieiiiieieieieeggeeieeeeccigecde@iiigifghiihhjhieffqeg~Ї@{tdle@l@kkhdfekddegjjmlleiikefghmemememlmhmkijjlghhjieegkfkjeeejeggggmeegfgmmimfmhfgmkkeeffffhlejleffjiddjddijddikjjiffjkggiiggeihhhheeeeggggggggggggggggiiiiggggggggffffffffeieikkjejjleigggeejhkkkkjjmjiillhhiiiijjljeeiifddddddddddddddddddddddddddddddddegegfeeeffffffgeeeffeffeiggfegfihgeefgfeeeefeefggfigefgfeehggejqffefeeefehfgffffffkffeegehgjghgefffffeeeffeeeeeheeehfffeegfffhjgefgeegeeeeefhgfhhigeeegjgiifgfeeeiffgfeeffeeehffeeeefefeeefeffeeeegefeggggffg@0u@;On?eeeee}iii}kdddqjellffe)@B@hhge@MP 5 Ca 7 8@fifjppC02 a eeeeeeddddeddAmhara ededdeeeekruf{gfgeeefeefefeeeeefffffffciddxjejdldjgdilllgihikfhdffdedfhjgdddddddeeedddeddeeeeeedeededddddededdddddddeeeded@dddeedeed@dddeedddddeeddjwdedfhdiddddehdddhddddddddddddddddddddddddddddgeddddleddgdedddddddffggfhhfehheegegggsgfifhhhggfeeeeeeeeefeedddddddddgeeeedeffffffffeffeefeeeeefedddfdeeefeedddedeeeddfeeedddsdddedeeeddeedddefffdeedgeffeefeeeffffdddefffdeedgeffeefeeefffffdddddggeeeefffeddddddddddddhiffiffefeieihgffgiifffevueeefiioneeeeeemieeeeegeeeeeffggigeeefgeggegegkeeewegeleflggffkhgfghejiggmgfgegpffj|edkdfehkgfgeeggiiggdMP05 37 Amhara eddddddedfddfddfddfddddieeeeedddedddddeededddedddddddeedddeeedeedfeedeffdeeepiiffffeefhtleegkou~eghmu}ideidejdejdeffff14.10N 38.80E eeex\@p= b@ףp= 0@snhqpi@W@jmsjoppiuffedAmhara fddddeffffffee,lݰ3ei;@?kk&[?Jr?(mD?$=C 4ma߈ G?B_/ghf= -??j۹3TP~?eeT.h?H8>y&?|VH?>?Bogo gedf/@`C@hfhikkeggfefffheneehfffhhiggegfggghheefegfggfefegecdededeeeeeceeicdiciieicidiccccecicdceg@ghffgfghtegimy|vH@}@rdleliedfekdddmeemffkiilenhhmfjfffhekfhgmhekkhhffflkkkklllljjjjiggggggffiiililjjjjililfhhhhfhfhfefekkggggeeffffkkkkiiiiiiiihfhfffffeeeeeeeegfgfffffeeeeeeeeheheffeieieeggggmmmmjjjjjjjjjhhhhjhjhfeihfejdfdgdhdhdgdhdfdfdgdgdfdfdfdfdeefegfj @V-?eeeee}diiiidddddefhdf/@`C@hd@Ca37 @a fiffjogffeegdedeBogo eedddddwfddthdhdldhidgsdedehdkefegfgffsfghhggffddddddmddg 38 Bobo fhsifhiklnppuginotx|iedjedkedkedffffee15.80N 38.50E ex4@q= ףB@R:@(@33333K@t|ipjr~|~dhfdedBogo ddffffegD4ĿX>}egP~?f{Kenuzi Nubians gef`C@jihgffggefeieoffhjeihfffhgghffgigggfeffeeekhgjhfnggfgggffeefegffgeeeeeeeeeedceeeegggihiieiciieiccidicceciiccdciigdeeiiie@gfihff|egӑ~sgngdiepkedfheddegjemffkgglenhgmhmemmmeehfejhkfgehhhekfkeelgmmehemmmfmhehheejfmkmffehkeijjjffigigffhjffihiimmgiijflinifgghgggfieehhiiggggggiikiggmgiiiiiihhhhggggffffiiiiiiiiiikihieiiieieejinnnnkkkkjjjjmmmmggggjkkkffiimiihiiiikjkjffiikkffhddddddddddddddddddddddddddddddddeeeegeheffhfggeeeeffhfffefeeeghfhefgfeeeffgggffgfffffeeeeeeeegfhefffffeeefffeeeffeeefeeeeeehgeeefehfffffjgefegeeeegeeeffffhffefgghe<@reeee?eeegg}iiddkdhehfff{edhhd`C@|ek@Cd 1 C03 a gfolggfiffdKenuzi Nubians @@jfsggggggfgftfddrkehdgdgddgijeheejgffeghhekfiieiehjjjljffhfigfhkeiehfhgegfhlee@ddedddededddhqdedeidkdllegegeggesffghhfffeeeefegdeezdfddddefdfdddddeeeeffemheiljjudtklkfphlhheeeeellleeeeiflgkleeffffffP@ei 39 Kenuzi Nubian fglhdfffghhjkdfffgiou~eddfddgedgedffffeee23.97N 32.78E <@xdweffffff? :b@??mfopplrqw}Kenuzi Nubians eeefddddeefffffe1A$?רƿgehhMHT?.Ir;X{A b>7peN)A?Teda 4@1@dfieggkjeggfifefhgffemeefffhhiegeejfeghfhghhkheggeefepegfgggheeeeegffeeeeeeeeeeegkhdgdfedffgfhhegiecciieicheddeidieegiecceccigegdgfefehfx@gefgyijggvewgko@m@xrqmdlepjedfgffddgiemiikgglenhhmhgemmmlmhmgjhffgfhiejfkeemejmjgmggmmjemgimgmmhmfmffhmhheefifkekffehlelllllllljimijijjjljjlliiiiggggilffgggggfhfhiiiigggghhhhiiiiiikkggmmiiiieeeeffffeefkllgggggeeijmmmmhhhhjjjjjiiiiiiiiiiikkfegdhdfdhdgdidididfdgdidfdgdhdjdeffeghfefeeeeefegfhfffffffeiffgfjjfggjgeggggfgeeeeegeegfgghefeeeefefegeffehgddx@eeeeidii}ishejffe4@ehfhe1@x@MS22 {ekgfCc 2 C04 a johgfheegdedgTeda nzegff(@(@eieeeffgfeegeeeeehfeeefeefwgddpkdfdgdfddeedex@edeeddddehqdedeiegdgdhdddddddddddddddddddddddddddddddddddddddddleeeefgeenhfifhhhgffnnnnnnnnnnnnnnzdedddddedddfeeddnnnnnnnnnnnnnngkedddededdeeddnikffeffffffffdddekfedeffddddeeiemiddddddhhhieegffggieeeeeeeeeeeeeMS22 40 Teda dddddddddddddddddddddddddddddddddedeeddeededdeedeedeeeeeedeedddeeefffggdgeffeyeeeeeeeefgnddddeeeeeeefhinosy|fddfddgddgddffffeeex20.50N 16.20E `@Q8@difk?5^IZ@333333+@333333+@yjxt~xpqeeTeda efddddffffeee #fgYd?⿣C3IkܿpT[ܿkυܿg߈ G?kʍMHT?ephe{Tuareg @eeighikgeghfifeffeoffhlggfffhghfgfegehifeghghhkeeheepfikfeghheggmfhjfheijejgehhhgekhcddddeedeeicgggifcdiidcdhiddidieiiifcdeicedi@hegehffehh~eeeegggef{ejgxyܖ@pqfmgpkedfgmeedigemeekggjefgjmemhmmmgghkgjjffgghgeejfhgemjjmjgmmmmmjemgmmmmgmhfhefgfhhegifkeiifmkmeiijjiijjggggiijjgggihhjjjjlliiiihhhhffggiiiggggfhfheeeegggghjhjkkkkhieiiieihhhhhhhhfhfheeeeiifijjlkeifiggeiggijkkkkkkkkhhhhhhhhgggghhhhiiiihhhhjjjjkkkkiillffihffffggffgghhffffggiiggggggffeffeeeeffggfeeehggeeegfeefffhefffgffffgfgefehfigeefeffffffegffghfggfeieffeffeefeeefeheffffffejfeeeefegeeeeefffefeeeeffeeeeegefegfefeeffehejgfgeghfhegeeegfifighfjfjggeffieeeeffgdd@~@|@eefefeeeffsdii}idiillgg{h@effe@MS25 Cc 9 @ekgfjoC05 a eeeeeeddddgddTuareg eededP@P@deeeehofefeegfeefeeeeefeeefeefpgeeohdhdgdgddgijffdieeedffjehdkeeeeeeddddededdedddeeeeeeeddddedddddddddddddddd@dddddddff@edddddeeededeiqdedehdfdeefddeddddfddddddgeddddeddddddddeddhdddddgeddleehjjefeggggtfghhhgffvuuikiffponffeeeeeeeeeeeeeeeeeeeeglllleefegieeeeeeeeefeggvgkifgflfeffeddegfihgdnggffgpggghhsfhegggieeffgfgegggdMS25 41 Tuareg dddddddfdddfddfdfffdeddhgfddddddedededdeedddddddefdddeedddfddddddfefgdddeefdpeeeeeeeefhpddddddeegggddddggikkgddgddgddgddffff22.78N 5.52E eeex@(\@Zd;U@ffffff?wjh~o0@.@zzpzrxxtndgfeTuareg dddddffffeii>e'?;@?fhak8e?+GEB"?M ނV?Ōrdhw@Z*$?QF9?MHT?efwc.@trX?RiffiansdeL7A`uA@ hgjgikffghgifeifielffgieghhheikkgfeghjeijmhioggeeeehjkgihegfhefgefjdicdeeeedeeeefgggecccigeiecgdgcggeggeeeecggeeii@ihifiihfjgkfeghzzv|pPx@lgojjledfhgdeegiemllfiilemfjmhgemmmfmhmijkkgfhgeegkfkeegegeegmgmmmmeegemmmmfmfgeemmkkeegjfekmfiimmmmiilliilljjhjhjiiilhfhhiifheihehekkggggggffffjjjjiiiiiiiieeeeggggeehjgggehekeljhiieejejemmmmkkkkkkkkmmmmmmmmjjiiggggkjkjgghhddddddddddddddddddddddddddddddddefeeeeeffhgfeeeeeeeefeeefggffffefifffffjffefgfffhfeegijgffggfhegeefeefeegfffgefffeefefeffehhefdds,@y@@eeeeesiisikiddffffeeehfL7A`uA@ hf@MX 3 Cd 3 C07 a eigfpphgffeegdedeo}eeRiffianseef@@syfpeffffggeeegeeeeefffeefeefclddtkdhdidhidfhjifeiigeghhgjfgfeeekjjhfffigghkeeefhgggfedeipdedfhdjdheeehdddddddhddddddddddddddddddddddddddddddddddlefeefefenfhfggffvuueeeflnmponieeelllkkkkgeljllkkllgfhhegffggigeeeeefggegfgw~egjffffffeefiifgggehhigmggegoggggfhefggggffeghffgfgedddMX03 42 Riffiansdddddddddeddddddddfddgfddddddddddddeddddddeededeeeeededdeddddeedeeggdfefddqeeeeeeeefhpdfffgijkorfjorwx|gedgedhediedffffee34.00N 5.00W ex@QeL@l5@̌@@33333sG@sgvn~~pnn{eeefddRiffiansddffffegi p6yn@?giihjI ,?Ϋʝ?;y{{?ji7^ ^?Q9?z^u?j?߈ G?>410ֿs?geph\g?eEgyptians 8@hegfihjigkffeefghiflffgkhhfffhhhhhffhihiiefhgifefhffhhhgfejhjknhilgggfheeijighjihigfilfiiliklddddcdddeeeefigiiciididicfcecfccicccecigieiiiix@ifiiiiieejhhhhkeff~egon|qeiednepkedfhfddegjemklfgglenhemimemmmeehfejjklhhhlggegkfkeeeeelggggmmmeffmmgmighmgfjmhheefifekmejgjgihkimjmjffigffhhjjlliiljjjmmggkjfgjlffgghhggfheeeeggggkkkkffffhhhhggiiffllggggeeeieejhllhhfheijjjjjjffggeieieijjjjkkkkmmmmkkkkmmmmjjmmmmjjkkmmkhkhiiiihhffhhffigjiggiiljfljjhjljfhfjlddddddddddddddddddddddddddddddddehffeheeeeffhggeffefeefgfgefeffifiefffeeffeefggfffegffehfekfjfefeefegegegeeeeefeffgfjgggefefffeeeffeeeeeeheefhffeeehfffhfjgegggffgefeeeegffiihgegjjjgijeiffiiffgfeffeffgfefeefeffefhhfegeeefefhehef@r@jeeff&1?ffeiggiidd}kinfdeeffehhhe8@ekx@MR13 Cd 2 C08 a gfppeffddddEgyptianegkees (@D@ed{}nwfsgefeefeeeefeeeeeeeeefffecjddulejdgdgddlhkleex@ededdddedddkodqdfidkdjfeeddddddddgddgdddddddddddddhddgddddddddddddddlefgjeeefggggtgfgggeggeeeeejeeeeddddddedeedeeeefffffffffeeeeefffdddddeeeeegdededddeddjeeeddeeeeejeeeeddddddedeedeeeefffffffffeeeeefffdddddeeeeeedededddeddjeeeddiiiidffdfffffeffedfdfeedfdddeeeedeedeefeeeefdfdeefdffddddheddddddddddddiiffiffefeifffkihgfefegeejieggefhgeeleleiiieeeeeeelhgheeeeffX@gigeeeegegeefgggeewekkfglefeelhfghhegfnfegeehfggffefemggghegggffeggggMR13 43 dddddEgyptians (Fellahi dfddddddddddgffdgddffedddddddeddeeeededeeeeededededdeeeeedeedfdgfhfffeefyeeeeeeeefhtkd@@efffffhikdefilrxgedgedgedgedffffeee23.97N 32.78E D@xdsQ?33333'd@??lhvypp|wwEgyptians eeefddddfffffffeelX}aN]?kdo?Z8 N?(mD?gX,?'NF=1G?w\bf #(n?,m a|yelh=ʕ9MHT?5,!YJ?%Of?wc.eH"1c?Hebrews Gz.?@L7A`uA@fehgiiigffhgfjfgfiheeeehehhfgfghgfgeiifeffggkgjhkknhglgggfkfhlkgghjifgifegifhkgcedceeeedeeeefeeegecfciegeieihecicceieeceeecheeeiiiiifhiihifijfkhifegddv@x~qmd8@ekkledfdgdfeghefklfiilenhgmimemmmeehfkijkkgghgeegkfkeeieeeegmggggmeefemgmmhmemhegmkkhhfifekfemmmmgijiggjjfflimnmnlmlmiinlfjiiiiggggffffeeeeggggggggeeeeiiiihihiggggffffeeeeiegelkhieieejgjhnnnnmmmmnnnnmmmmnnnnmmmmiiiimkmkffiiffffddddddddddddddddddddddddddddddddeffeeeegigfeeeehfekfgfeeeeeeeeeghhgehif@@Mbp?eeee}i}iikiddddfgeeGz.?@ehghdL7A`uA@h@ekgfCj 3 l@C09 a ppihffeegdedgHebrews gflfiejgegeeeffeeeeefgeeeefeefeffefddsjdhdidhidlhejiodedfhdjejgeehdddhdddddddddddhddddddddddddddddhdddddddddkefegfeffqfgheeeglkfkkffomellleeeeellleeeegfeeeeeeeeg 44 Hebrews ekefefeefhtkeddgediediedffffeeex31.87N 35.22E @\(lM@hiljL7A`9@yT@33333G@|wvuxddHebrews gdddddffffekE!?~ *J?K,0?g<ɓMHT?ephgBabylonians vJ@@`F@fffjiikgffgehghgihmggghegifejhlknhgfgifkfhlkgfjhhgifefghilhkcceeeeeeeeceehecgehcdieiheececeeeeeeecheeceXiiiiihiiiifjfhiffegxqq{ngxdplokedfdhddffjgkffkiihfnhemememjjklfhedegkfkjelelleggmgmgmeeeemggmimemheeekkeefifmkmgiiiiffgghfjhffiiiijjjjfhhhhfhfhffifeekegggggggghhhhkkkkieieieieeeeeffffehleeeffigkklkeieieigihhjijjjjkkkkmmmmkkkkmmiiiigggghhhhffgggfegeeffggeeefffefgeegfeefeffeeffegfegeffgfefeeeeegehgfefffefffffffeeeffeeeeeeeeeehfffeehfffhhjgfeggggefgeeffiighjjjjjjefdd@P@eeeexxdddkddddevJ@@`F@dhgdX@Cj 4 y@eihfppC10 a ffeedddgBabylonians eedXXdeeeedddddgeeeefeeefehefefffeedgddwldjdidigdheefiekemlghhjhffggfefijjfhfgipdedfheidefdddhddddddddddddddddddddddddddddddddddddddkeeefgegfqfgheeegvuflffpjljligkklelllllflgkeeg 45 Babylonians jjggfffffhtkfddgddhddhddffff31.98N 44.98E eeexP@q= ףp(@QC@333333@vu;@5@nnntrn|ddgdBabylonians dddddffffekQ)?(mD?ghbi?egwc.@trX?Rwala Bededouin @@@C@ihekjeghfefefheeeefhhhhhghheifgefffghfheehffpejggggghegghfhgfgijejjegffgghdeedeeddddddcfeieidcididhiiiddddciidcdgecgieediie@eehfgegf{jfkhgiefegvxvm@`i@gdpklkedfdfeedldemiikiilenhgmimemfmeehfeeeegfhfgeejfhkejjmjgmmmmjememmmmmfmfmheekefifjljeiimimimiijjjjjggjjggjjmmmmiiiiiiillhffiiggeiheeeehieighhhhkkkkiiiiggggehehfffgegeehhhhkkkkggggggggeeeeggeieeeemmmmjjjjjjjjkkmljgjgjjjjhhhhffffjgjgffjjhhhddddddddddddddddddddddddddddddddeffeeeefgigfeeeekfekfjreeeffeegegeeeeeeefffeehgffjggggfgegeeffgfeefeegfgfefeeeeegeeggfgfeeegeeefefhhhe @`@MbP?eeeeddii}iqdqfgfehdf@@@C@he@MD 4 Cj 2 C11 a ekgfjoihfgfedeRwala Bedouin hdnrpefgeefeefeeefefeeeffeeeeefwhddrkdfdidffdlllfffk@eeddededdddddehddddfdieeedddddddhdddgdddghdddddddddddddddddddddddddglegjefeffegepfghhggfedddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddgggdfffddddmhghhehevumiikfjhiponegeekkgekggglglleehehhhhleglgfhgggeeeegfegegffwqgkkleffdfheghhfhjgkgdffghddgfggfegheighgeeggghhfgehgedddMD04 46 Rwala Bedouin dddddddddeddddddeeggdggdeddddeeeeeeeeefhtkddgijjjkldefmptvfddhedhedhedffffee34.55N 38.30E ex@Clg)@%CF@ffffff@fffff:@7@hli{y|oppvvx{eeefddRwala Bedouin ddefeffffeff ӢTWпeekeh3>~c?X}afg|<ǝ,տEQѿދY/?X>}e?%@Gv`8ؿghfeMHT?eTurks vC@gfhh A@jiigeeffihfiflffghhhggheghghgifeggghhhhejhiinhglggefheeijighjfhgglilhiillkjiddddddddeefihcfiiedeiididiciidcdcieeciedeiiihx@iiihiiijfhhkfeg@qtq|fb {@mplhkedfmidddhjekklfiilenhgmgmemmmemhmeijklhhhlmegkfkeejmmmegmmmmgmmmeemmmmifemeejmkheefifeleiiiijhggggffifggfildijjjjjjjiilnffhfggeiffffieieggggggggjjhfiiiiggggffffeeeeeeeejjjjffffggggggggeeifkleieieeeejimmmmjjjjiiiiggggjjhghgljjjjjjjmfmfffijlllhlkkfffffhhjjjjjddddddddddddddddddddddddddddddddefeeeeigfeffeeefeeefeffffgeeegfhgggefffeefefeeefffhgefffeffekfjrffeefeeeeheffffeeehfffehggfffffeeeffeeeeeeeheefhffefehfffffjgefeghggefffeggegiiggffjjgegifgffgfgif@fegff{Gz?feefgf}ddiikȕifffeeehhgevC@ A@hix@MB 1 Ci 4 h@C12 a efppffffeeddddTurks egjeex@x@edfd}}ggggeeeefeeeefeffeffffeefclddskdhdhdhfdllllhllekodedfhdideehdeddddhhddgdgddhdddddddddhdhddddddddddhdddledddgdddddddddggghgggiieegeegfpfhfhhhgggeeeeeeeeeeeimiieeeeeehhhgeeheeggeeefgeeeegeegeefwegfifglhfeffkhdghhfhjhdogegeehfehfhhfelgfghhegededihfedgMB01 47 ddeddTurks dfdfddegeeedeegfeddhhgfdeedddeddeedddeddeeddeddedddeeeeedededdegfffefdeeseeeeeeeefydd@@ddddeghijdddefhilsgddhddjedjedfffgeee40.00N 32.90E P@x}slS㥛A@fffff.@Q%E@ ףp=J1@jkxnpojso|pTurks eeefddddfffffffegk&"ҿar@?(mD?iҝ 激3RXٿg'NF=|yeph,(?ri-?%Of?wc.e@trX?Gheg Albanians n*4@ffeehhiiikffgffjffheikfeghifffieehghfeiiigfefghkhegikhgmggghfeeijkhhhhggffhfgehfdiedceedeehigifiiecciiiiciiighceciceieigifhf؝@ihhfjfexgzs|i@i@nlfkedfiedddhjemkljiilenhhmhmemfmgghkkijihgghdegkfkkejeglegmgmmmjmmfhmmmmemeeeekkeefigglgigelefjimkjglgggjjijhjjlffiimmmmllllhkjmfgggggggfheeeeggggggggggggiiiiiiiihhhhiiiiffffeeeeeeeeffffifiigleieeiefgjnnnnllllnnnnkkhfhfhfhfjgjgffhhddddddddddddddddddddddddddddddddeeeeeeefeggfeeeefeifgfefeeeeeeeggheffffejffffjfeffjjhhhgjfhgffggeffefffgeeeeeeeeegegfeffeeeefeffehgff@ q@y&1|?eee@eggiiiikdeeehghen*4@؝@EG 1 }ggfhCe 1 C23 a ppfihffffdeGheg Albanians |eei(@(@fipegfffggeffeeeeeeffffefeffclddtjejdhdhldgiifhdeifegfiheijjjjjgffihfgggfehfhljjljgdddd؝@dddddddddiodrdfidheeeddddddddgdddddddeddddddddddddddddddddddddddlegefeefeofifhhhfeeiigjjjjkfffeeeeekddedddeddeeiigjjjjkffeeeeeefddedddeddddffdeffdfdddddddeeegeieievsuegeeenmnonkigemmmmeeeeehmkkgeeelllgeeeffggfgeeefgfeeegeegEG01 48 Gheg (Albanians)ddfdgdgdgdddeededdffdeddhggddefddddeeedeeddddeddddddedeeedeedddeedfffeedffeedriizdddghhhkklefghjkklnhediediedjedffffeeex41.33N 19.78E |@Q_@qkhgI +1@fffffd@lR@lxvo|r~eeGheg Albanians efddddffffegghdX,(?hii yHK?h!Q?8ޗ?^'6?v?g߈ G?IEG!T?oW?heeRomans L7A`D@+@hfkihghgffeehhigihqifihhgfhifejhghkmifjhlkngfegifkfhkkfejhhgijeggiililkjgficceeeedeeeeeeechecccheheeigeceheeeeeecedeeeeiiiiihiiiiffepgnns{p@ussok@@gkedfigddffjkmeekiimfnhgmememememhmeijklgieidegkfkjeeeeggmgimemheiieeigejeggjjihjhjjjjffffjgmjhhllhhhhiiiiffjjiiilfihhiiggfhfeffeekgggggggjjhjkkkkhieiggegeeeeffffhhhhllllegegegegjjjjkkkkhihiggggjjjjmmmmmmmmkkkkmmkkkkjjmmkjkjlllljjjjiiiiihihffjkjddddddddddddddddddddddddddddddddhegffegeggfggeeffffffjggfgfhefeefffffggffggfhfffggeffekfkfefgeeeeggffffffkfefffffeeeffeeeeeeeeehhffeehfffhhjgffgggghegggeeeegiigfjjjjeejm@s@V-?eeeexxiddldddififggeL7A`D@+@ihgfEI 9 Ce 3 ggfhppC14 a eeeeeeddddeddRomans eedededdedddddgefeeeeeeeefefeeeeefeffeefgeevkejdidikdjhjodedfheidjeeddddhdddhdddhddgfddddddddddhdddddddddddeddgkehgeeeegeofghhhggfveuilifggonekeeilleeegleeeeeefdEI09 49 Romans edddefdfdddeddfgdfeddddifgeeedddedededddddedeeeededeeedeeeddddeeddeffhdfeffeueeeeeeeeii{de@hedhediediedgggg41.67N 12.23E deex؛@`")T@(\2@QM@}lkh{Gj[@= ףpH@vw|l||txt{ddfdRomans ddddeffeffffel'@ԕ=?-I?9?ghg(Q?,$ʿoW?eg4S(U+5O@;?Basques hggfE@y&1hhjiikffgfffhgfihgigehggfffffgfffeifkhgfieefghiehhgghhhfhejgjhmhgigifefhijfgieggielhiiljledddeeeedegeggieihececieeeccheeddeeeeeecidgfeeii8@iiiiighiefhuupxi|@ @S|nlfledfilddfhikmeekiikefggmememfmkijllfhhldegkfkjejmegmmmmeeffmmmmifemeejmhhffgifelgffeifggggffiiiijjffjjiijjlllljjlliijjijhhhhfheiffffeeeeggggggggffffggggiiiiiiiihhhhkkkkggggggggigkklgllehgiggjjjjggjjjjjjggeeiiggiiiihhkkjddddddddddddddddddddddddddddddddefhghlgfefeefehfgffffffeeehnĞ@k@;On?@eeee}iiiikdddffggffehE@y&1gd8@Ce 8 l@C15 a hgfhppeeeeeeeddddeddeeBasques de(@8@{gmggfeegefeeefgefhefffffefclddwjeidldiidlfhllljodrdfidhelkeeefeefemfgghefgjeieeejiipeleeeeeeeeefgeeeeggefeeeewegfffefhligghhehiigoeh|eddeeelEX08 50 Basques efeeeeeeeddeeeeedededdeeeeeeddeedgfgfhefgdhe}jjggffffiddddddffffgdddggijkliediediediedfffgde41.67N 1.00W ex@YA@;O>@Q4@HzN@QD@pjhjnprztzzffedfdBasques ddfffffffek 3?ghgeoX?eIrish J@Zffihjhikffeeihifmigghgfggffehfehfehfehgeighgfhheihfghkhghejgiimjhigifhfhfefgjigiglglhiiklkjdddeedddeefefhehieieiieedheiheeeeegdedediideeiiih0@iiihhifgjjjhhhhkeelhdnrif@pledkedfkgdedhikmjleiikemfgmememfmlmhmkiiilfghldegkfkjeegmmeffmmmimemeekkfffifellgffhhiijjffiiffjjijggggiilljjjjiijkliiggggggeieeffeeggggggiieeggiiiiiiiiiiiiiifhfhggeijjiiffffieeiggeijjjjmmmmkkkkjjmmjjjjmmmmmmggjjiiiikkgilllllllleegglffffkkllllddddddddddddddddddddddddddddddddgghgfeeiffffeeheeeefffgjggeegiiffffeefffgffghffgfeffeifgfefffefiffefgefffefeeffeeeeeeeeeehhffeeeifffhfjgeegggfhefeeefgffihhgfgjgfgiieiihhfgefheifhfeghgihhggfgfffgggghhfeffeeeefhghghP@s@w|eggfZd;?0@feefggxiddxkndvffgfgfZehggeJ@hg0@ER 6 Cg 3 C17 a fhppeeeeeeddddIrish eddee(@0@de{vgygfgeegeeeeffffffeeffffeefclddykdjdldjkdgefeeifgeigeggffgeiekgeigjhjeggfgiiiefgeheelfjkjkjfj{dedehdidjeeddddddddhddddddddddddddddddddddddddddddddddleddgdddddddddddddddddddddddddddddhfheeeeeegemffhehfheefffffgeeeegdddddddddeeeegfffffffffffeeeeeeeeeeededeeeddffiffeeeedddddddddeeeefffffffffffeeeeeeeeeesedeeeegeddiiiidffdffeedfffdfhfhdggdggheeeeeeeeffddddddfffeggfgfffeffeddddddddddddiiffiffeeiiffffeeieieeeellleeeeeelggeeeeeeegeee33333SY@efgeeeeeeeeeeeelfffweghefflffeefjddfhhfhhidogfggfpefhf|fekgfgfheefeefeER06 51 dfdfdIrish effdddeefgfffeedgddhhffefdeeedddgddeddddeddddddededdfdeeddddeedgeeeegeedqii|dddddeefffddeffhiiifedfedfedfedggeeeee52.70N 8.92W @xxish|X@|?5/@GzP@Q_@zGN@jipnprtop~|{Irish ffedfdddfffffffegk(=XP68?jgE}?DA?v?gX,?S?<ɓ9.jӿq?JJ'D^Uɱ׿hfeoX?+5O@eͫVCT?Lapps ,Q@5@ehhgikigfghfjfefeefffehiiggieehfhfghgggieggfhefghhhhhehgeeegeegegihhfhgkifeegeeeeeeeeeedccdegeddddddefieccchdhhciidcieedceefefegfx@efffvfjjeeehhke}gdcpW~0}@kfdkfdfkhdffjdjmeekiikefghmememfmimhmkeeeefehfgdeeifhjmjjmmemmmmmmjehhmmmmmfmemeekigehifjljeiijigghhiiiijjiiiigiijffijjijjjjjjiiiikigggggggghhiieeiiggggggggiiiigggghhgigggghhhhggggggggggggiiiiggggfhfhgggggjgjmmmmjjjjiiiiiiiiggggjjjjeeeeggggjjjjkkkklljjmkmkhhijllffddddddddddddddddddddddddddddddddeefeeeeegfeejgilfghefeeefffehgeeeeefejeeeeeeeiffeffiieeeigefgghfegghggefhhffgghhhffgeeeeeefefggl<@m@L7A`?feeeegi}iiiidllmlgf,Q@hdege5@x@EP 4 kheeCg 4 C20 a joeeeeeeddddeLapps ddeedx@|@eingggffggfgffffffeefclddljdfddddidlllkeedex@eeeeddedei{eedefefddddddddhddddddddddddddddddddddddddddddddddieehheeeeeeeekffiegeheddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddddffffdggdgghfeefeeefefeeddddfdddliiedddddddddddeeeeeeeeeeeeeieeeeleeeheefleegeekeeeeeeeeeeeeeeeeeegeffEP04 52 Lapps dedfddfdddefgdffddfgddddhgffddddedddeededeedddddddedddeeeddedddedeffeeddffedepegefefeeixdedd@@dddeeeedddeeefgggedgedgedgedffffeeex68.45N 22.50E T@PJ@knjlS3@A@33333Q@fffffA@vxyrxpxws{|xffLapps edfdddefeffffegmſeef*xKĺzB7yOB<vg<ɓ򿽛Biʿ??!5?hheeYurak Samoyed I@ehegikigfggfigehehgfffehhfhghgggekkfefeheeeeglgggihghgkghgffeinefgehjmidefeeedddddcediicididiiiiddcicciidecdeigi@fefeeggeffvegikk\oL4hlfj@dkfdgghdgghdekklfiilenhhmimemmmffhkkeeeegeggdeeiehemmjmljmmmmmmjeeemmmmmfmemeeeffhlgjjjjgggjlffffggggeeeegggghhhhggggeeeeeeeefefelleieiggihihjjjjggggggggllllhhhhjjjjjjhfddddddddddddddddddddddddddddddddfefeeeeeggfeffgffjfeegfggeefffefgeegfgffffeeffeegffgfefggehgjegffeeeeffeheeefffeeiffefgffeeeeeefeeefffeeeehffeeffeeeeeggffegggfegggfffieggigjfggjjjejeedd@e@ܝ@efeffggi}iiiidwdohI@jehe@RU 4 Ec 4 ljeejoE04 a ffeeeddYurak Samoyed eeeee@@ddddddotfffeegfhffeefeefclddlledddddfdljhdhfefddddddddddddddddhddddddddddddddddddddddddddkeeheeeeeeeeekgiffmkkkikkenmpmnhlhhfghikfgfegeffegflhhghgeeeeeeeeeeegeeeeeeeeeeedRU04 53 Yurak (Samoyed) ededddddeddddfdddfgdgdd?gdfddddededeedddddddeedddedddeeedeeeeeeefdffefghfeedveeeeeeeeixdkeddddddddddddddeffgfedgedgedgedffff67.58N 52.17E eeex@ףp= C@L7A`e,@Q^7@kjvQ+G@Q6@|sdhfdYurak Samoyed edddfffffeg(=ь4o#\O<ɓge,g@hf%Of?wc.@trX?RussianshfL7A`UJ@vD@hhjiikffefjigfimhgghheggfhffggiiihhieefhigehhhhhdhefgjgjhkgheiigffgiffeihhiilelfiikjiddcdddffhhhieiiccciiefeiciiceheedecidfii@iiiiigiiegzpdsPP@@4bokfdkedfledddgkhkeekhemfnhgmememfmkjjklfihdegkfkjlmlhmmmmmffmmmmimemeegmegifgmligglgeiiiieeeeffffiiiiiilliilliilllllliilljjjjljhhiiggfheeffkkggggggjjjjggggiiiiggggiikkllllggggggkkkkggllggggiijjmmmmjjmmjjjjmmmmgggggggggggghhhhiiiiffhhkkkkmmmmhhkklllhhhddddddddddddddddddddddddddddddddj@Ȃ@{Gz?eeee}idiikȞffedhL7A`UJ@vD@gg@RF 1 Ch11 @C24 a jhehppeeeeeeddddeddeeRussiansdex@@}hgfgeegfeeeefefeeeefffffefcldd{ldldkdkideeggeihdhgififflkijkhiiifeehkiifgehfffljjjdeekvdedfhdiedddddddddddddddlefefeefenfghghggfvuukeeekmljonfggemmmhheleikllgelghekheeeeeggeeeegfeeeeeewlfffedeeefddkhdgfhfhhidogfgfeiff|edmdifeghfeegiiffgdddRF01 54 Russiansdddfdedddddfeddgfddddfg@dddddddedddededdddeefddddedddddeeddddededfehdeededoii}dddddddeeedeeeeeffigddhddiddiddffffee52.73N 41.47E exh@T㥛pJ@Et3@(\bA@QQ@{G:B@wijlxhlx~~~~|ffedfdRussiansddffffelU;?-I?<ɓdhhe!AE?a3$?eAbkhaz E@gffe(\bD@hikkffggffhefeefffeieggejehikehoggfiheeiggicccedeegggcecieccideeciiidciideececcidghigg`@hhehgijhfkhiedddddddddddfmfeddjghmllfiilenhjmhmemmmijihffhfgkfheejjmmhgmmmmmlelefmmmmimemhfhmhheefifkhlgiikkiillggiijjjjgiijffiilmlmimifeiiiiggggjjeeeeggggggjjjjkkkkiiiiggggjeeeifieiejjjjkkkkfheieieiggjjjjjjggjjhghggggghghghhlllfkffflhfhfljllllddddddddddddddddddddddddddddddddhhhffeefgfeeeeeeeeeeefffgfjfeeegeheegegffeeeeegeffheeffgeefefffeeefejffffjfefffeeeffeefeeeehfffeegfffhhigffgfihgfgfffgfffihhiffjehfiifffii|@i@neJ +?eee}iiididdleeeeffehfhfE@(\bD@gi`@RI 3 Ci12 ē@a ghjoggeeAbkhaz `@`@eeyltfqffeegeeefehefffffefciddrhdfdldfidlllllldhrdedeiddddeddddfdddddddfdddhddddddddddhdddddddddddleeegeegeofghhfvuueeefeeeponleeemmeeeeeegeleeeeeeigeeeegeeeegeeRI03 55 dddddAbkhaz ddddfddddddddgdddddeddedddddddededdddddddddddddddeddeddeedeeeddeddfgeeedmhefefeeefkddefgilmnpqfinqx{}gedhediediedffffeee42.52N 41.88E L@xkMbXe@V-2-@(\a@Qn@RX@e}|~t|wrrAbkhaz ddfdddddefeffffefZg 4ma<ɓj۹3TehhۢH%? r?ւ?g-Jz?gd9?Armenians @F@fegfhhjiikfgfhlffgiffffifegghmjhiinhhnggefgfhijfiihhgijehgiilideeedeefffiiiicicieciiehieecdeiiihif̜@ghiiegzz@jw\Wx@ilgledfmddddgkkmlleiikefggmemememlmhmeijklghhdegkfkjelejegmmmmemjemmmfmemeejmkheejifekejjjjiiiimjjggggggfhhhhheeeeggggggggeeeeiiiiiiiiffffffffeeeeeeheleeeegggjjhhhhggggjijiffffddddddddddddddddddddddddddddddddeefeffg@|@y&1|?eeee}dddiksjfehhgd@F@̜@RJ 1 hiehCi10 @C25 a oleeeeeeddddeArmenians ddeed@̜@egkgfffeghffffffefclddtkdhdidhideedd̜@ddddddddejodtdfhdddkefefeeffoeeemeei 56 Armenians fixddeelmnnopgjp}iddiddjddleeffffeeex40.82N 44.50E @vM@skˡE0@(\•D@q= ףU@QkE@|xmffArmenians edfdddffffekGTF?(mD?g,(?hgeeheKurd @B@@F@feihiiigffghefgeiflffghiieeihfighghghiiegghifefhgejfffgjgjjnggjggefffekfggiihigfflfiilhijddeeedeefffceiieciidfeicihdccichieecciggde|@hiiiifiihggijjjeeggg|@i@ogdhkpledfmeddehiemffkiilenhemhmemfmeehfhjjggghhegkfkkefljmeggmmmgmeeffmmmmhmemeeeekefifekmifjljeiiiijjjjiiiiihljfgjghjkhhiiiligggggggfheefeigggggiiiiffffiiiihhhhiiiiffffffffffffeeeeefefkjhfffllieiggeifgiikkkkjkjjjjjjjjjjjjjjjjjjjjkgiiiijijhihihliliiiiikjkijkjjhhkkijddddddddddddddddddddddddddddddddefeeeeegigfeeeffeeeeheeefffffeeeeefffefgjfefeffgfgefggeeefeegfffgfefefeefggfkmeeeeeeeeegfheffeeehffffeigfegfffffeeeffeeeeefiheeehfffeehfffhhjgegegfffefeegehffiiggggjjfehiegeegheifiegfeeeeffffgfeeegeefggfgegeeeefeeefeefefegnh@@g@S㥫?effffeeffg}iid}ksdd}hegfffe@B@@F@hghe|@MA11 Ci11 @ggfhppa ggffeegdddehkKurd fgeefdx@